Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04350 310 / 9e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59540 307 / 2e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G59530 303 / 3e-101 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06650 293 / 4e-97 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT2G30840 291 / 2e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30830 290 / 7e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43440 288 / 5e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G03400 285 / 4e-94 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06640 279 / 1e-91 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G135800 [exp] 571 / 0 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G222300 [exp] 490 / 1e-174 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.004G083100 [exp] 464 / 2e-164 AT1G04350 287 / 5e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 461 / 6e-163 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073100 [exp] 348 / 2e-118 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.011G156200 [exp] 335 / 2e-113 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G073300 [exp] 333 / 1e-112 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073166 [exp] 333 / 1e-112 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.013G045000 [exp] 315 / 2e-105 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000612 [exp] 386 / 2e-133 AT5G59540 337 / 2e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10033879 [exp] 358 / 1e-122 AT5G59540 312 / 8e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10033878 [exp] 354 / 6e-118 AT5G59540 308 / 4e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10021943 [exp] 338 / 1e-114 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037796 [exp] 322 / 1e-108 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022195 [exp] 321 / 8e-108 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027585 [exp] 316 / 5e-106 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10017080 [exp] 313 / 5e-105 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022191 [exp] 309 / 2e-103 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022415 [exp] 308 / 9e-103 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.017G136000.1 pacid=42813413 polypeptide=Potri.017G136000.1.p locus=Potri.017G136000 ID=Potri.017G136000.1.v4.1 annot-version=v4.1 ATGGAAGTCACGATTTCCAATTTTGAAGAAGGCTCAAACTATGACATAGACAAGGAAGTGAAAGCAATCGATGCAACAAAAGCGGGTGTTAAGGGACTTG TTGATTCTGGTGTGACCAGGATTCCCAGGTGTTTTGTCCACCCACCAGAGAATGTGCTGAAGTCATCATCCAAGTCTAGCAATATCAGCCATCAGGTTCC AATTATAGACTTCGAAGGGTTTGAAAGTTGTCGGCGATCAGAGGTGGTAAATGAGATCCGGAAAGCATCAGAAGAATGGGGTTTCTTTCAAATTATTAAC CACGGAACTCCAGTTGCTGTCATGGATGAGATGTTAGCAGGGGTGAAACGATTCCACGAGCAACCCCAGGAAGCGAAGGCGGAGCTGTACTCTCGTGATC CTAAACAAAGAGTGAAGTTCTTCTATGGAGGAGTGGTTCTGACCAAAGAAACAGCGGTTTGGAGGGATACAGTGGCAATAAATTTTCAGGATGGTGAACT TGACCCTGAACTATATCCTGAAGTTTTAAGAGAAGAGTTAAGTGAATACACAAAACACATGACCAAAATCAGCAAGACTCTGTCTGAGCTCTTATCAGAA GCACTCGGGCTTCGTTGTGCCTACCTTTCAAGCATTGAATGCATGGATACTCAAGCATTGGCGGGTAACTATTACCCACTTTGTCCTGAACCAGACTTGA CAATGGGCACCACCAAGCATACAGACCCTTCTTTTCTGACTATTCTTATTCAAGACAACATGGGTGGCCTCCAAGTTCATCATCAAAATCAATGGGTAGA TGTCCCACCTCTGCAAGGAGCACTTGTAGTAAATATAGGGGACTTCATGCAGCTTATCACTAATGACAAGTTCAGAAGTGTGCAGCATAGAGTTTTGGCT CAAGAAGTCGGACCCCGGACATCAGTTGCAAGCTTTTTCTTTCCAGGTGCAGCAAACAAATTGAAACCATATGGGGTAATAAAGGAGCTTCTCTCTGACG ACACACCCATCTACAGGGCAACTCATTTGGCTGAATTCATGGGTCAATACATGTCCACAGGATCATCTATCTCAGTCCTTTCTCCTTTTAAAGTGACGAG GCCATGCTAG
AA sequence Show only first row Show all	>Potri.017G136000.1 pacid=42813413 polypeptide=Potri.017G136000.1.p locus=Potri.017G136000 ID=Potri.017G136000.1.v4.1 annot-version=v4.1 MEVTISNFEEGSNYDIDKEVKAIDATKAGVKGLVDSGVTRIPRCFVHPPENVLKSSSKSSNISHQVPIIDFEGFESCRRSEVVNEIRKASEEWGFFQIIN HGTPVAVMDEMLAGVKRFHEQPQEAKAELYSRDPKQRVKFFYGGVVLTKETAVWRDTVAINFQDGELDPELYPEVLREELSEYTKHMTKISKTLSELLSE ALGLRCAYLSSIECMDTQALAGNYYPLCPEPDLTMGTTKHTDPSFLTILIQDNMGGLQVHHQNQWVDVPPLQGALVVNIGDFMQLITNDKFRSVQHRVLA QEVGPRTSVASFFFPGAANKLKPYGVIKELLSDDTPIYRATHLAEFMGQYMSTGSSISVLSPFKVTRPC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Potri.017G136000 [exp]	0	1
AT5G52300		LTI65, RD29B	RESPONSIVE TO DESSICATION 29B,...		Potri.015G143950 [exp]	7.61	0.6565
AT2G04350		LACS8	long-chain acyl-CoA synthetase...		Potri.014G169400 [exp]	8.24	0.6247
AT1G67420			Zn-dependent exopeptidases sup...		Potri.010G060500 [exp]	18.73	0.5823
AT3G59990		MAP2B	methionine aminopeptidase 2B (...		Potri.017G133200 [exp]	27.92	0.6009
AT4G21390		B120	S-locus lectin protein kinase ...		Potri.001G437950 [exp]	36.90	0.6202
AT5G16600	MYB	ATMYB43	myb domain protein 43 (.1)		Potri.004G086300 [exp]	37.60	0.5815
AT2G37180		PIP2C, PIP2;3, ...	RESPONSIVE TO DESICCATION 28, ...		Potri.016G089500 [exp]	39.34	0.5584	Pt-PIP2.2
AT4G10380		AtNIP5;1, NIP5;...	NOD26-LIKE MIP 8, NOD26-LIKE M...		Potri.001G455000 [exp]	49.02	0.5667
AT4G00720		ASKTHETA, ATSK3...	SHAGGY-LIKE PROTEIN KINASE THE...		Potri.014G075100 [exp]	66.66	0.4804
AT4G23740			Leucine-rich repeat protein ki...		Potri.012G033200 [exp]	66.94	0.5743

Compare expression of checked genes

Potri.017G136000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.