Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66200 60 / 6e-11 ATGSR2, GLN1;2 glutamine synthetase 1;2, glutamine synthase clone F11 (.1.2.3) AT5G16570 58 / 2e-10 GLN1;4 glutamine synthetase 1;4 (.1) AT5G37600 57 / 5e-10 ATGLN1;1, GLN1;1, ATGSR1 ,GSR 1 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) AT5G35630 50 / 2e-07 ATGSL1, GLN2, GS2 GLUTAMINE SYNTHETASE LIKE 1, glutamine synthetase 2 (.1.2.3) AT3G17820 47 / 1e-06 GLN1;3, GLN1.3, ATGSKB6 GLUTAMINE SYNTHETASE 1;3, ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE KB6, glutamine synthetase 1.3 (.1) AT1G48470 43 / 5e-05 GLN1;5 glutamine synthetase 1;5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G131100 [exp] 58 / 3e-10 AT1G66200 600 / 0.0 glutamine synthetase 1;2, glutamine synthase clone F11 (.1.2.3) Potri.007G069600 [exp] 54 / 5e-09 AT5G37600 653 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) Potri.005G093200 [exp] 53 / 2e-08 AT1G66200 647 / 0.0 glutamine synthetase 1;2, glutamine synthase clone F11 (.1.2.3) Potri.015G034700 [exp] 51 / 8e-08 AT5G37600 632 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) Potri.008G200100 [exp] 50 / 2e-07 AT5G35630 704 / 0.0 GLUTAMINE SYNTHETASE LIKE 1, glutamine synthetase 2 (.1.2.3) Potri.012G043900 [exp] 49 / 3e-07 AT5G37600 600 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) Potri.010G029100 [exp] 49 / 6e-07 AT5G35630 711 / 0.0 GLUTAMINE SYNTHETASE LIKE 1, glutamine synthetase 2 (.1.2.3) Potri.017G127901 [exp] 41 / 5e-05 AT1G66200 106 / 2e-28 glutamine synthetase 1;2, glutamine synthase clone F11 (.1.2.3) Potri.004G085400 [exp] 0 / 1 AT1G66200 593 / 0.0 glutamine synthetase 1;2, glutamine synthase clone F11 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004037 [exp] 54 / 1e-08 AT5G37600 671 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) Lus10020812 [exp] 54 / 1e-08 AT5G37600 672 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) Lus10010203 [exp] 51 / 9e-08 AT5G37600 655 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) Lus10017404 [exp] 50 / 1e-07 AT5G37600 642 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1) Lus10001115 [exp] 45 / 6e-06 AT5G35630 701 / 0.0 GLUTAMINE SYNTHETASE LIKE 1, glutamine synthetase 2 (.1.2.3) Lus10034016 [exp] 45 / 6e-06 AT5G35630 748 / 0.0 GLUTAMINE SYNTHETASE LIKE 1, glutamine synthetase 2 (.1.2.3) Lus10012536 [exp] 40 / 0.0003 AT5G37600 599 / 0.0 ARABIDOPSIS THALIANA GLUTAMINE SYNTHASE CLONE R1, ARABIDOPSIS GLUTAMINE SYNTHASE 1;1, glutamine synthase clone R1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.017G138201.1 pacid=42814432 polypeptide=Potri.017G138201.1.p locus=Potri.017G138201 ID=Potri.017G138201.1.v4.1 annot-version=v4.1 ATGTCAGACCCAAGGCACTTGGACTTGACAATCAACCAAGTTCAGGACAACATTATTCCTTTTACTGTTGCATGGGGTCAAAGATGGTTGCCCAGCAGTG GAGAATGCAACACCATCAAATTCTTTCCAGCATTCATGAGCCTTACTTTGGAGCTTATTGGACGCTATGTTCTGCCTGATAGATCTGTTTTGCCGATAAT GTATCGCCACTTAGACCTCAGAGGATTACTGTTTTCATTGTACCTTCATTTGATCCAAAGCCAATGGATTACTGGTCAGTTTTTATTTCTTTGTACCTTA ATGGATGCTGCAAGTGTGCATGTTTTCAGTACTTTTATTGTTGGAACTCTCAAGAAATTAGACTTTTGTTTTGTCAAGGAGATTGGAAAGGAGCGGGGGC ACACACAAATGACAGGCTATGAAATCATCAAGAAAGCAATTGAAAAGCTTGGTCTGAGGCATAAAGAACACATTTCAGCTTATGGAGAACGGAAAGAGCA GAGACCCACTGGATGA
AA sequence Show only first row Show all	>Potri.017G138201.1 pacid=42814432 polypeptide=Potri.017G138201.1.p locus=Potri.017G138201 ID=Potri.017G138201.1.v4.1 annot-version=v4.1 MSDPRHLDLTINQVQDNIIPFTVAWGQRWLPSSGECNTIKFFPAFMSLTLELIGRYVLPDRSVLPIMYRHLDLRGLLFSLYLHLIQSQWITGQFLFLCTL MDAASVHVFSTFIVGTLKKLDFCFVKEIGKERGHTQMTGYEIIKKAIEKLGLRHKEHISAYGERKEQRPTG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.017G138201 [exp]	0	1
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Potri.007G100500 [exp]	2.23	0.9831	Pt-NHX8.1
AT5G17680			disease resistance protein (TI...		Potri.019G070001 [exp]	6.40	0.9702
					Potri.004G184650 [exp]	9.53	0.9795
AT2G19080			metaxin-related (.1)		Potri.001G064609 [exp]	16.12	0.9664
AT5G36930			Disease resistance protein (TI...		Potri.007G143200 [exp]	16.52	0.9703
AT1G50520		CYP705A27	"cytochrome P450, family 705, ...		Potri.009G065100 [exp]	17.20	0.9604
AT5G36930			Disease resistance protein (TI...		Potri.007G142600 [exp]	17.20	0.9707
AT1G13270		MAP1B, MAP1C	methionine aminopeptidase 1B (...		Potri.010G129101 [exp]	18.24	0.9546
AT3G50310		MKKK20, MAPKKK2...	MAPKK kinase 20, mitogen-activ...		Potri.009G131100 [exp]	19.28	0.9399
					Potri.001G284032 [exp]	19.89	0.9747

Compare expression of checked genes

Potri.017G138201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.