Potri.017G140400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65810 129 / 1e-34 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT1G65780 127 / 5e-34 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G37030 107 / 3e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G37150 93 / 6e-22 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G37160 82 / 4e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G140200 370 / 2e-121 AT1G65780 816 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.017G140501 321 / 6e-103 AT1G65780 798 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.017G140601 311 / 2e-99 AT1G65780 777 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.004G077100 257 / 3e-80 AT1G65810 478 / 3e-152 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.004G077650 254 / 2e-78 AT1G65810 559 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.004G077700 253 / 2e-78 AT1G65810 818 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.004G077800 155 / 9e-44 AT1G65780 719 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.004G077600 151 / 2e-42 AT1G65810 843 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.004G077500 140 / 2e-38 AT1G65810 827 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035776 88 / 5e-20 AT1G65810 633 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10035774 77 / 2e-16 AT1G65810 541 / 7e-180 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10037353 64 / 6e-12 AT1G65810 543 / 2e-177 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Potri.017G140400.2 pacid=42813822 polypeptide=Potri.017G140400.2.p locus=Potri.017G140400 ID=Potri.017G140400.2.v4.1 annot-version=v4.1
ATGATGGAGAAGACTACAGCGAAAACTGAAGAAGAAGTTGCTGGTAGAAGCTTGTTAGACTTGGTGTTCTCTTGGTCTATCACGGATGTACTTAACAGAG
ATCTTTACAAAAATCAGGTGAAGAAGATACCAGAGACATTCACGTCAACGTCACATTACATGAAGTCATTCATTCCTGCTCTAATCGAGGAAACTCGTGC
AGATTTGTGCTCAAACATGATGAAGGTCTCCCAAGCACCTACAAGGGAGATCTTTTCAATTGAAAGATCAAAAGAGTATAAACCTCCCAAAGACTTGTTT
TATAAGATGTGGTTGAATAGAATGAGAAAAACTGGAAATGTGAAAGGAATATACGAGCCTGAGGTTGGAGATCTCATTGCTTTGACAGATGCAAGACCCA
AAGACATTGCTGATTTGAACAGGCCTGGGATAAACTATCTTCTTGCATATGTTCAGAGGCTATCTAATGGGCTGGATGATGACGATAATCATGAAACGTT
ATGGCTGGATGATGACGATAATAATGAAACGTTATCAATTCTCACATCCAAACCCATTCAATTTGAACGTAGAAAACAAGCAGAATAA
AA sequence
>Potri.017G140400.2 pacid=42813822 polypeptide=Potri.017G140400.2.p locus=Potri.017G140400 ID=Potri.017G140400.2.v4.1 annot-version=v4.1
MMEKTTAKTEEEVAGRSLLDLVFSWSITDVLNRDLYKNQVKKIPETFTSTSHYMKSFIPALIEETRADLCSNMMKVSQAPTREIFSIERSKEYKPPKDLF
YKMWLNRMRKTGNVKGIYEPEVGDLIALTDARPKDIADLNRPGINYLLAYVQRLSNGLDDDDNHETLWLDDDDNNETLSILTSKPIQFERRKQAE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G65810 P-loop containing nucleoside t... Potri.017G140400 0 1
Potri.011G015725 11.13 0.9080
AT3G54340 MADS AP3, ATAP3 APETALA 3, K-box region and MA... Potri.002G028400 15.74 0.9387 Pt-APETALA3.1
AT5G19600 SULTR3;5 sulfate transporter 3;5 (.1) Potri.006G156038 25.09 0.9304
AT5G61850 LFY LFY3, LFY LEAFY 3, floral meristem ident... Potri.015G106900 26.60 0.8916 Pt-LEAFY.1
AT5G19600 SULTR3;5 sulfate transporter 3;5 (.1) Potri.006G158900 27.60 0.9303
AT1G22150 SULTR1;3 sulfate transporter 1;3 (.1) Potri.005G167300 31.89 0.9278
AT1G09240 ATNAS3 ARABIDOPSIS THALIANA NICOTIANA... Potri.005G014300 32.61 0.9295
AT4G27300 S-locus lectin protein kinase ... Potri.011G126251 38.41 0.8992
AT1G03670 ankyrin repeat family protein ... Potri.013G133700 42.66 0.9273
AT5G16990 Zinc-binding dehydrogenase fam... Potri.017G002600 43.54 0.9200

Potri.017G140400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.