Potri.017G141100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73230 195 / 7e-65 Nascent polypeptide-associated complex NAC (.1)
AT1G17880 193 / 4e-64 ATBTF3 basic transcription factor 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G078300 236 / 4e-81 AT1G73230 197 / 2e-65 Nascent polypeptide-associated complex NAC (.1)
Potri.015G029800 183 / 5e-60 AT1G17880 232 / 4e-79 basic transcription factor 3 (.1)
Potri.012G037900 182 / 2e-59 AT1G73230 225 / 1e-76 Nascent polypeptide-associated complex NAC (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039661 210 / 1e-70 AT1G17880 253 / 2e-87 basic transcription factor 3 (.1)
Lus10031551 208 / 4e-70 AT1G17880 255 / 2e-88 basic transcription factor 3 (.1)
Lus10015123 207 / 2e-69 AT1G17880 253 / 1e-87 basic transcription factor 3 (.1)
Lus10027180 195 / 7e-65 AT1G17880 238 / 1e-81 basic transcription factor 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
Representative CDS sequence
>Potri.017G141100.2 pacid=42813286 polypeptide=Potri.017G141100.2.p locus=Potri.017G141100 ID=Potri.017G141100.2.v4.1 annot-version=v4.1
ATGAATAGAGAGAAGCTTATGAAGATGGCTGGTTCTGTTCGAACCGGTGGCAAGGGAACCATGAGAAGAAAGAAGAAGGCAGTGCACAAGCCATCAACAA
CTGATGACAAGAAGCTGCAAAGTACTTTGAAGAGAATTGGGGTTAATACAATTCCAGCTATTGAAGAAGTGAACATCTTCAAGGATGATTTGGTTATTCA
GTTTGTTAATCCTAAAGTTCAAGCCTCTATTCCTGCTAACACTTGGGTTATTTCTGGCACTCCTCAAACCAGAAAACTGCAAGATATTCTTCCAGGAATC
ATCAACCAACTTGGGCCAGATAACTTGGACAACCTTAGGAAGTTAGCAGAACAGTTTCAAAAGGAGATGCCAGCTGGTGAGGCAGGTGCTGCACAAGAAG
ATGATGATGTCCCAGATCTTGTGGCTGGTGAGACCTTTGAAGCTGTTGCTGAAGAGGGTCAGAAGTAG
AA sequence
>Potri.017G141100.2 pacid=42813286 polypeptide=Potri.017G141100.2.p locus=Potri.017G141100 ID=Potri.017G141100.2.v4.1 annot-version=v4.1
MNREKLMKMAGSVRTGGKGTMRRKKKAVHKPSTTDDKKLQSTLKRIGVNTIPAIEEVNIFKDDLVIQFVNPKVQASIPANTWVISGTPQTRKLQDILPGI
INQLGPDNLDNLRKLAEQFQKEMPAGEAGAAQEDDDVPDLVAGETFEAVAEEGQK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G73230 Nascent polypeptide-associated... Potri.017G141100 0 1
AT5G48760 Ribosomal protein L13 family p... Potri.017G054600 2.00 0.9532 RPL13.2
AT2G07340 PFD1 PREFOLDIN 1 (.1.2) Potri.006G079700 3.74 0.9302
AT1G70600 Ribosomal protein L18e/L15 sup... Potri.006G202300 4.47 0.9523 Pt-RPL27.4
AT3G59540 Ribosomal L38e protein family ... Potri.007G131800 8.24 0.9448
AT1G26880 Ribosomal protein L34e superfa... Potri.015G106466 9.53 0.9417
AT5G02960 Ribosomal protein S12/S23 fami... Potri.016G085800 9.79 0.9455 Pt-RPS23.5
AT5G27700 Ribosomal protein S21e (.1) Potri.005G026000 10.72 0.9443
AT2G18110 Translation elongation factor... Potri.001G224700 10.77 0.9176
AT1G73230 Nascent polypeptide-associated... Potri.004G078300 11.22 0.9094
AT1G26880 Ribosomal protein L34e superfa... Potri.015G106532 14.69 0.9200

Potri.017G141100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.