Potri.017G144061 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37478 154 / 7e-48 TPX2 (targeting protein for Xklp2) protein family (.1)
AT3G01015 86 / 6e-20 TPX2 (targeting protein for Xklp2) protein family (.1)
AT5G15510 85 / 2e-19 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
AT1G03780 55 / 4e-09 AtTPX2, TPX2 targeting protein for XKLP2 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G092100 94 / 2e-22 AT5G15510 403 / 5e-136 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Potri.004G118700 72 / 6e-15 AT5G15510 410 / 8e-139 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Potri.017G013100 54 / 1e-08 AT1G03780 667 / 0.0 targeting protein for XKLP2 (.1.2.3)
Potri.007G138600 52 / 4e-08 AT1G03780 672 / 0.0 targeting protein for XKLP2 (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020800 139 / 4e-42 AT5G37478 148 / 1e-45 TPX2 (targeting protein for Xklp2) protein family (.1)
Lus10007382 138 / 1e-41 AT5G37478 149 / 1e-45 TPX2 (targeting protein for Xklp2) protein family (.1)
Lus10010706 81 / 4e-18 AT5G15510 476 / 2e-165 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Lus10030836 79 / 2e-17 AT3G01015 413 / 8e-141 TPX2 (targeting protein for Xklp2) protein family (.1)
Lus10030650 79 / 2e-17 AT5G15510 404 / 4e-137 TPX2 (targeting protein for Xklp2) protein family (.1), TPX2 (targeting protein for Xklp2) protein family (.2)
Lus10017715 54 / 2e-08 AT1G03780 687 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10018608 47 / 3e-06 AT1G03780 741 / 0.0 targeting protein for XKLP2 (.1.2.3)
Lus10039844 46 / 6e-06 AT1G03780 689 / 0.0 targeting protein for XKLP2 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06886 TPX2 Targeting protein for Xklp2 (TPX2) domain
Representative CDS sequence
>Potri.017G144061.1 pacid=42813835 polypeptide=Potri.017G144061.1.p locus=Potri.017G144061 ID=Potri.017G144061.1.v4.1 annot-version=v4.1
ATGGAGAAAGCACATACAAAATCTGCTCTTAAGAAGCTTGTTAAGGCTAGCTCACAGTCTGCACCATGGAGCAATGCTGCTAGAGGAATGGCAAAAGATG
ATCTCAAGGATCCGCTTTATGACAAATCCAAGGTTGCCCCAAAACCTTTTGCAAAAGAAAACACTAAGCCCCAAGAATTCAAACTCCACACTGGACAAAG
AGCTCTCAAACGTGCCATGTTCAACTATTCTGTGGCAACCAAGATATATATGAATGAGCAACAGAAGAGGCAAATAGAGAGGATACAAAAGATCATAGAA
GAAGAAGAGGTTCGTACGATGAGGAAGGAGATGGTTCCAAGAGCTCAATTGATGCCTTACTTTGACAGACCTTTCTTTCCCCAAAGATCAAGCAGGCCAT
TGACAGTTCCTAGAGAGCCAAGTTTCCACATGGTGAACAGCAAGTGTTGGAGCTGCATCCCTGAGGATGAACTTTACTACTACTTTGAACATGCTCATCC
CCATGATCATGCCTGGAAGCCTGTTAAGTAA
AA sequence
>Potri.017G144061.1 pacid=42813835 polypeptide=Potri.017G144061.1.p locus=Potri.017G144061 ID=Potri.017G144061.1.v4.1 annot-version=v4.1
MEKAHTKSALKKLVKASSQSAPWSNAARGMAKDDLKDPLYDKSKVAPKPFAKENTKPQEFKLHTGQRALKRAMFNYSVATKIYMNEQQKRQIERIQKIIE
EEEVRTMRKEMVPRAQLMPYFDRPFFPQRSSRPLTVPREPSFHMVNSKCWSCIPEDELYYYFEHAHPHDHAWKPVK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G37478 TPX2 (targeting protein for Xk... Potri.017G144061 0 1
AT2G44740 CYCP4;1 cyclin p4;1 (.1) Potri.012G114600 1.41 0.9417
AT4G18640 MRH1 morphogenesis of root hair 1, ... Potri.004G058100 7.07 0.9006
AT1G16860 Ubiquitin-specific protease fa... Potri.010G252500 8.12 0.9360
AT1G63430 Leucine-rich repeat protein ki... Potri.003G124800 8.24 0.9265
AT3G55990 TBL29, ESK1 TRICHOME BIREFRINGENCE-LIKE 29... Potri.008G069900 8.66 0.9297
AT1G79620 Leucine-rich repeat protein ki... Potri.016G144100 9.05 0.8911
AT2G21300 ATP binding microtubule motor ... Potri.004G162800 10.19 0.9081
AT1G16860 Ubiquitin-specific protease fa... Potri.008G006000 12.84 0.9241
AT5G54670 KATC, ATK3 KINESIN-LIKE PROTEIN IN ARABID... Potri.011G131900 15.16 0.9026 ATK2.1
AT5G51540 Zincin-like metalloproteases f... Potri.015G129300 15.29 0.9150

Potri.017G144061 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.