RPS10.3 (Potri.017G146700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPS10.3
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25740 179 / 2e-58 RNA binding Plectin/S10 domain-containing protein (.1.2)
AT5G52650 180 / 3e-58 RNA binding Plectin/S10 domain-containing protein (.1)
AT5G41520 170 / 3e-54 RNA binding Plectin/S10 domain-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G027900 201 / 1e-66 AT5G52650 179 / 8e-58 RNA binding Plectin/S10 domain-containing protein (.1)
Potri.005G040100 200 / 3e-66 AT4G25740 177 / 2e-57 RNA binding Plectin/S10 domain-containing protein (.1.2)
Potri.004G073500 200 / 4e-66 AT4G25740 178 / 6e-58 RNA binding Plectin/S10 domain-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039282 195 / 4e-64 AT4G25740 236 / 1e-80 RNA binding Plectin/S10 domain-containing protein (.1.2)
Lus10038846 191 / 2e-59 AT5G52660 292 / 2e-96 Homeodomain-like superfamily protein (.1.2)
Lus10024669 193 / 3e-59 AT1G63910 260 / 2e-82 myb domain protein 103 (.1)
Lus10032298 192 / 7e-59 AT1G63910 260 / 2e-82 myb domain protein 103 (.1)
Lus10014966 162 / 5e-50 AT4G25740 216 / 5e-71 RNA binding Plectin/S10 domain-containing protein (.1.2)
Lus10027519 110 / 1e-31 AT4G25740 104 / 8e-30 RNA binding Plectin/S10 domain-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0123 HTH PF03501 S10_plectin Plectin/S10 domain
Representative CDS sequence
>Potri.017G146700.4 pacid=42812878 polypeptide=Potri.017G146700.4.p locus=Potri.017G146700 ID=Potri.017G146700.4.v4.1 annot-version=v4.1
ATGATTATTTCAGAGAAGAACAGAAGAGAGATCTCCAAGTACCTCTTTCAAGAGGGAGTTTGCTATGCAAAAAAAGATTACAATCTTGCAAAGCACCCGG
AGATTGATGTTCCCAATCTCCAGGTTATTAAGCTCATGCAGAGCTTCAAATCCAAGGAATATGTTCGCGAGACATTTGCATGGATGTACTACTACTGGTA
TCTTACCAATGATGGAATTGAGTTTTTGAGGACTTATCTGAATCTTCCATCAGAAATTGTTCCTGCTACCTTGAAGAAACAGGCAAAGCCTGCTGGTGGT
CGCCCATTTGGTGGTCCACCTGGTGACCGTCCCCGAGGCCCACCTCGCTTTGAGGGAGACCGTCCAAGATTTGGTGACCGTGATGGTTATCGTGGGGGCC
CACGAGGGGTTGAAGGTGGTGAGAAGGGAGGAGCTCCAGCAGATTACCAGCCTGCATTTAGGGGCTCTGGTGGAAGGCCTGGCTTTGGTCGTGGAGGAGG
AGGTTACGGTGCTGGTCAAACTAGTACTCCTGACTTTGCTTGA
AA sequence
>Potri.017G146700.4 pacid=42812878 polypeptide=Potri.017G146700.4.p locus=Potri.017G146700 ID=Potri.017G146700.4.v4.1 annot-version=v4.1
MIISEKNRREISKYLFQEGVCYAKKDYNLAKHPEIDVPNLQVIKLMQSFKSKEYVRETFAWMYYYWYLTNDGIEFLRTYLNLPSEIVPATLKKQAKPAGG
RPFGGPPGDRPRGPPRFEGDRPRFGDRDGYRGGPRGVEGGEKGGAPADYQPAFRGSGGRPGFGRGGGGYGAGQTSTPDFA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25740 RNA binding Plectin/S10 domain... Potri.017G146700 0 1 RPS10.3
AT2G19730 Ribosomal L28e protein family ... Potri.003G045500 2.23 0.9692
AT5G04800 Ribosomal S17 family protein (... Potri.008G017300 2.44 0.9645
AT5G09500 Ribosomal protein S19 family p... Potri.002G043200 3.00 0.9594
AT4G14320 Zinc-binding ribosomal protein... Potri.007G071800 4.00 0.9577
AT3G60770 Ribosomal protein S13/S15 (.1) Potri.014G068600 4.24 0.9556 RPS13.1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.011G148700 4.89 0.9523 RPL9.5
AT3G13580 Ribosomal protein L30/L7 famil... Potri.010G250900 6.00 0.9522 Pt-RPL7.4
AT4G10450 Ribosomal protein L6 family (.... Potri.011G147700 7.07 0.9563 Pt-RPL9.4
AT5G45775 Ribosomal L5P family protein (... Potri.006G181600 10.48 0.9409 RPL16.2
AT1G70600 Ribosomal protein L18e/L15 sup... Potri.016G069000 10.95 0.9505

Potri.017G146700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.