Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01490 87 / 9e-23 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G52750 77 / 5e-19 Heavy metal transport/detoxification superfamily protein (.1) AT5G52760 73 / 7e-18 Copper transport protein family (.1) AT5G52740 65 / 1e-14 Copper transport protein family (.1) AT1G63950 53 / 4e-10 Heavy metal transport/detoxification superfamily protein (.1) AT1G55790 52 / 3e-09 Domain of unknown function (DUF2431) (.1), Domain of unknown function (DUF2431) (.2) AT5G52770 50 / 4e-09 Copper transport protein family (.1) AT5G27690 47 / 3e-07 Heavy metal transport/detoxification superfamily protein (.1) AT5G26690 45 / 6e-07 Heavy metal transport/detoxification superfamily protein (.1) AT5G23760 44 / 7e-07 Copper transport protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G073000 [exp] 111 / 1e-32 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147500 [exp] 102 / 5e-29 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147400 [exp] 100 / 1e-28 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073100 [exp] 98 / 2e-27 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 91 / 1e-24 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.001G099500 [exp] 88 / 1e-23 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G163400 [exp] 87 / 6e-23 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 86 / 4e-22 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147200 [exp] 77 / 2e-19 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036395 [exp] 86 / 5e-22 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 84 / 3e-21 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 86 / 9e-21 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 83 / 9e-21 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027523 [exp] 81 / 2e-20 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 83 / 3e-20 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10028762 [exp] 79 / 5e-20 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027522 [exp] 67 / 4e-15 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039285 [exp] 67 / 5e-15 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10024672 [exp] 64 / 3e-14 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.017G147300.1 pacid=42814473 polypeptide=Potri.017G147300.1.p locus=Potri.017G147300 ID=Potri.017G147300.1.v4.1 annot-version=v4.1 ATGAAGAAAGCTGTGCTGAGATTGGATCTGCATGAAGAGAAAGCTAAGAAGAAAGCCATGAAGACAGTCTCTAGGCTTCCAGGGGTGCATTCAATATCCA TGGAGATGAAGGACCAGAAGCTGACAGTGATAGGGAACATTGATCCAGTACACATAGTTGCCAAACTGAGAAAGCTGTGTTGCACAGAAATAGTTACAGT AGAACCGGCAAAAGAACCTGAAAAGAAGAAGGAAGAGCCGAAGAAGCAAGATCAAGATCTTCACATCACTGCTTATCATTACCATTATCCACATGTTGTA AGTGTTGAGGAGGATCCTAATGCAATTTGTGTCATTTCTTAA
AA sequence Show only first row Show all	>Potri.017G147300.1 pacid=42814473 polypeptide=Potri.017G147300.1.p locus=Potri.017G147300 ID=Potri.017G147300.1.v4.1 annot-version=v4.1 MKKAVLRLDLHEEKAKKKAMKTVSRLPGVHSISMEMKDQKLTVIGNIDPVHIVAKLRKLCCTEIVTVEPAKEPEKKKEEPKKQDQDLHITAYHYHYPHVV SVEEDPNAICVIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01490			Heavy metal transport/detoxifi...		Potri.017G147300 [exp]	0	1
AT3G49690	MYB	ATMYB84, RAX3	REGULATOR OF AXILLARY MERISTEM...		Potri.018G058800 [exp]	5.56	0.9078
AT3G14470			NB-ARC domain-containing disea...		Potri.017G121500 [exp]	12.40	0.9064
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Potri.015G143400 [exp]	18.33	0.9050
AT4G02860			Phenazine biosynthesis PhzC/Ph...		Potri.010G175700 [exp]	25.09	0.8859
AT1G10480	C2H2ZnF	ZFP5	zinc finger protein 5 (.1)		Potri.008G193400 [exp]	25.13	0.8938
AT1G47340			F-box and associated interacti...		Potri.008G216000 [exp]	27.16	0.8959
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Potri.001G025200 [exp]	28.53	0.8905
					Potri.003G152800 [exp]	29.18	0.8130
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Potri.018G070900 [exp]	29.59	0.9002
AT1G51190	AP2_ERF	PLT2	PLETHORA 2, Integrase-type DNA...		Potri.001G018400 [exp]	31.38	0.8972	RAP21

Compare expression of checked genes

Potri.017G147300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.