Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01490 75 / 1e-17 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G52760 63 / 9e-14 Copper transport protein family (.1) AT5G52750 60 / 3e-12 Heavy metal transport/detoxification superfamily protein (.1) AT5G52740 59 / 5e-12 Copper transport protein family (.1) AT5G52770 54 / 3e-10 Copper transport protein family (.1) AT3G05920 43 / 6e-06 Heavy metal transport/detoxification superfamily protein (.1) AT5G26690 41 / 3e-05 Heavy metal transport/detoxification superfamily protein (.1) AT5G23760 40 / 3e-05 Copper transport protein family (.1) AT1G63950 39 / 9e-05 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G147500 [exp] 135 / 3e-42 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073000 [exp] 122 / 1e-36 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073100 [exp] 109 / 8e-32 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.001G099500 [exp] 97 / 9e-27 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147200 [exp] 91 / 2e-24 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147000 [exp] 90 / 4e-24 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 89 / 1e-23 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147300 [exp] 80 / 2e-20 AT1G01490 87 / 2e-22 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 79 / 3e-19 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014967 [exp] 84 / 4e-21 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 85 / 2e-20 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027523 [exp] 81 / 2e-20 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10028762 [exp] 81 / 2e-20 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 80 / 9e-19 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 76 / 9e-18 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10017520 [exp] 74 / 9e-18 AT1G01490 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 74 / 2e-17 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039285 [exp] 71 / 2e-16 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007455 [exp] 69 / 2e-14 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.017G147400.1 pacid=42812902 polypeptide=Potri.017G147400.1.p locus=Potri.017G147400 ID=Potri.017G147400.1.v4.1 annot-version=v4.1 ATGGAAATTAAGAAAGCTGTGTTGAAATTGGAGTTGCATGATAAGAAAGCCAAGAAAAAAGCCATGACGATAGTCTCTGGTCTTTCAGGGGTGGATTCAG TATCCATCGACATGAAGGACAAGAAGATGACAGTGATAGGGGACATTGATCCAGTATGCATAGTGGCCAAACTGAGAAAGCTGTGTGGCACAGAAATAGT CACAGTAGGACCGGCAAAAGAGCCTGAGAAGAAAAAAGATGAGCCGCCGAAGAAGCCAGAAGGAGATCAGAAGAAAGATCCCGAGCCTGTGGCTTACCTG GCCTATCATCCTCATATGCCCCCATATTGTTATGTTTCATGTGTAGAGGATAATCAAAATGCTTGTGTCATTTCTTAA
AA sequence Show only first row Show all	>Potri.017G147400.1 pacid=42812902 polypeptide=Potri.017G147400.1.p locus=Potri.017G147400 ID=Potri.017G147400.1.v4.1 annot-version=v4.1 MEIKKAVLKLELHDKKAKKKAMTIVSGLSGVDSVSIDMKDKKMTVIGDIDPVCIVAKLRKLCGTEIVTVGPAKEPEKKKDEPPKKPEGDQKKDPEPVAYL AYHPHMPPYCYVSCVEDNQNACVIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G01490			Heavy metal transport/detoxifi...		Potri.017G147400 [exp]	0	1
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Potri.016G076100 [exp]	1.73	0.9429
AT2G17040	NAC	ANAC036	NAC domain containing protein ...		Potri.009G141600 [exp]	2.44	0.9397
AT1G35520	ARF	ARF15	auxin response factor 15 (.1)		Potri.004G220100 [exp]	3.60	0.8968
					Potri.012G014800 [exp]	4.58	0.9121
AT3G20600		NDR1	non race-specific disease resi...		Potri.011G133900 [exp]	5.29	0.8713	Pt-NDR1.2
AT3G48090		ATEDS1, EDS1	enhanced disease susceptibilit...		Potri.015G069600 [exp]	5.65	0.9168	EDS1.2
AT3G28890		AtRLP43	receptor like protein 43 (.1.2...		Potri.012G010445 [exp]	6.48	0.9143
AT5G48380		BIR1	BAK1-interacting receptor-like...		Potri.010G178050 [exp]	9.74	0.9163
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.013G106200 [exp]	10.58	0.9076
AT1G01340		ACBK1, ATCNGC10	cyclic nucleotide gated channe...		Potri.014G097900 [exp]	10.81	0.9239

Compare expression of checked genes

Potri.017G147400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.