Potri.017G149900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G51160 332 / 2e-118 SNARE-like superfamily protein (.1.2)
AT5G02280 67 / 2e-14 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G069800 69 / 2e-15 AT5G02280 267 / 1e-93 SNARE-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039298 310 / 8e-110 AT1G51160 323 / 5e-115 SNARE-like superfamily protein (.1.2)
Lus10027541 310 / 8e-110 AT1G51160 323 / 5e-115 SNARE-like superfamily protein (.1.2)
Lus10023793 67 / 1e-14 AT5G02280 261 / 2e-91 SNARE-like superfamily protein (.1)
Lus10010836 65 / 8e-14 AT5G02280 259 / 2e-90 SNARE-like superfamily protein (.1)
Lus10024390 65 / 1e-13 AT5G02280 263 / 4e-92 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF04628 Sedlin_N Sedlin, N-terminal conserved region
Representative CDS sequence
>Potri.017G149900.2 pacid=42812938 polypeptide=Potri.017G149900.2.p locus=Potri.017G149900 ID=Potri.017G149900.2.v4.1 annot-version=v4.1
ATGCAGTTTTTTGGAGGGTCAGACATAAGTCCATCACCACCAGCACCAACTGCATCAGGGAACAATGCACACATGATGTATGTCTTTAACAGGAACGGCG
TTTGTTTGCTTTATAGAGAATGGAATCGCCCACTTCACACTCTTAATGCTCAGCAAGACCACAAGCTCATGTTTGGTTTGCTCTTCTCTCTCAAATCCTT
GACTGCCAAGATGGATCCCACAAGTATGGATAAAGGAAACCTTGGGGTGCCTCAATTACCAGGACAAGGTTGTTCGTTTCACAGTTTTCGTACAAATACA
TACAAGCTTAGCTTCATGGAAACTCCTTCTGGGATAAAGATTATCCTGATTACTCATCCCAAAACTGGTGATCTACGGGAATCCTTAAAGTACATTTATA
ACTTGTATGTTGAATATGTAGTCAAGAATCCAATCTACACTCCTGGAGCCCCTATCAGGTGTGAGTTGTTCAACACTTCTCTTGATCAATATGTAAGAAG
CATTTCATAG
AA sequence
>Potri.017G149900.2 pacid=42812938 polypeptide=Potri.017G149900.2.p locus=Potri.017G149900 ID=Potri.017G149900.2.v4.1 annot-version=v4.1
MQFFGGSDISPSPPAPTASGNNAHMMYVFNRNGVCLLYREWNRPLHTLNAQQDHKLMFGLLFSLKSLTAKMDPTSMDKGNLGVPQLPGQGCSFHSFRTNT
YKLSFMETPSGIKIILITHPKTGDLRESLKYIYNLYVEYVVKNPIYTPGAPIRCELFNTSLDQYVRSIS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G51160 SNARE-like superfamily protein... Potri.017G149900 0 1
AT5G15320 unknown protein Potri.002G024900 1.00 0.9553
AT2G32580 Protein of unknown function (D... Potri.014G155600 2.44 0.9533
AT3G44150 unknown protein Potri.016G068000 3.74 0.9542
AT1G47830 SNARE-like superfamily protein... Potri.002G022900 5.47 0.9409
AT4G28088 Low temperature and salt respo... Potri.006G182500 6.92 0.9357
AT2G30050 transducin family protein / WD... Potri.008G141300 7.48 0.9456
AT5G52210 ATGB1, ATARLB1 GTP-binding protein 1 (.1.2) Potri.012G138500 9.16 0.9210
AT2G42310 unknown protein Potri.016G051400 9.48 0.9204
AT4G39220 ATRER1A Rer1 family protein (.1) Potri.004G156900 10.09 0.9323 Pt-RER1.2
AT5G63400 ADK1 adenylate kinase 1 (.1.2) Potri.012G095300 10.58 0.9347

Potri.017G149900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.