Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ACTI.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17860 191 / 6e-62 Kunitz family trypsin and protease inhibitor protein (.1) AT1G73260 123 / 7e-35 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1) AT1G73325 100 / 6e-26 Kunitz family trypsin and protease inhibitor protein (.1) AT1G73330 64 / 1e-12 ATDR4 drought-repressed 4 (.1) AT1G72290 45 / 1e-05 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G067900 [exp] 286 / 5e-99 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067800 [exp] 221 / 2e-73 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153400 [exp] 216 / 2e-71 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153466 [exp] 215 / 4e-71 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153600 [exp] 210 / 3e-69 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067600 [exp] 194 / 5e-63 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1) Potri.019G006900 [exp] 99 / 1e-25 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1) Potri.001G309900 [exp] 95 / 3e-24 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G000400 [exp] 87 / 3e-21 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007889 [exp] 185 / 6e-59 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039163 [exp] 182 / 7e-58 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013770 [exp] 182 / 8e-58 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007890 [exp] 180 / 7e-57 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039210 [exp] 177 / 4e-56 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1) Lus10042301 [exp] 177 / 5e-56 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007892 [exp] 176 / 2e-55 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10030354 [exp] 176 / 3e-55 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007902 [exp] 176 / 3e-55 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10026357 [exp] 175 / 3e-55 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0066 [poplar] [flax] Trefoil PF00197 [poplar] [flax] Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence Show only first row Show all	>Potri.017G153200.1 pacid=42813542 polypeptide=Potri.017G153200.1.p locus=Potri.017G153200 ID=Potri.017G153200.1.v4.1 annot-version=v4.1 ATGAATTATCCAATGTTATTGTTGTGCTTACTCCTCCTTGCCTTTGCCTGCACAAAGCAGTCAATAGCTGCTGCTGAACCAGTGCTGGACATTGATGGTG AAAAGCTTGTAGCAGGCACCGAATACTATATCTTGCCAGTGTTCCGTGGGAGAGGAGGTGGGATTACAATGGCTAGCAACAAAACCAGCTGCCCACTTGC TGTTGTCCAAGACCGTCTTGAGGTATCAAAGGGTCTTCCACTTACTTTCACACCAGCTGCCGACGACAAGAAAGGTGTGATCCTTGTTTCTACTGATCTT AACATCAAGTTTTTAGCTAAGACAACATGTCCCCAATCAACTGTATGGAAGATTACAAAGTCTTCGAACTCGAAGGTACAATGGTTTGTGTCAACTGGTG GGGTTGAAGGAAATCCTGGTTTTAATACGGTGACCAACTGGTTCCAGATTGAGAAAGCTGATGATGACTACAAGATTGTTTTCTGTCCTACTAAAGTTTG TAACTGTGGAGTTTTATGCAGGGATATTGGGATTTATATTGAGGATAATGGGACTAGAACACTGTCTCTTAGTGATGCATTACAACCTTTCAAAGTCCAG TTCAAGAAAGCTTTGAAGAAATACTCGTGA
AA sequence Show only first row Show all	>Potri.017G153200.1 pacid=42813542 polypeptide=Potri.017G153200.1.p locus=Potri.017G153200 ID=Potri.017G153200.1.v4.1 annot-version=v4.1 MNYPMLLLCLLLLAFACTKQSIAAAEPVLDIDGEKLVAGTEYYILPVFRGRGGGITMASNKTSCPLAVVQDRLEVSKGLPLTFTPAADDKKGVILVSTDL NIKFLAKTTCPQSTVWKITKSSNSKVQWFVSTGGVEGNPGFNTVTNWFQIEKADDDYKIVFCPTKVCNCGVLCRDIGIYIEDNGTRTLSLSDALQPFKVQ FKKALKKYS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17860			Kunitz family trypsin and prot...		Potri.017G153200 [exp]	0	1	Pt-ACTI.2
AT5G63930			Leucine-rich repeat protein ki...		Potri.013G051300 [exp]	3.16	0.7637
AT2G18700		ATTPSB, ATTPS11	TREHALOSE-6-PHOSPHATE SYNTHASE...		Potri.018G097700 [exp]	5.29	0.7266
AT5G44440			FAD-binding Berberine family p...		Potri.011G157900 [exp]	10.81	0.6809
AT5G21170		AKINBETA1	5'-AMP-activated protein kinas...		Potri.001G220800 [exp]	19.05	0.6944
AT5G57685		LSB1, ATGDU3	LESS SUSCEPTIBLE TO BSCTV 1, A...		Potri.006G267900 [exp]	22.13	0.6875
AT1G71960		ATABCG25, ABCG2...	Arabidopsis thaliana ATP-bindi...		Potri.013G111900 [exp]	24.28	0.6787
AT2G38600			HAD superfamily, subfamily III...		Potri.016G139700 [exp]	31.74	0.6589
AT3G24310	MYB	MYB305, ATMYB71	MYB DOMAIN PROTEIN 71, myb dom...		Potri.010G064000 [exp]	33.67	0.6858	Pt-MYB305.2
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Potri.011G125900 [exp]	33.76	0.6941
AT3G30210	MYB	ATMYB121	myb domain protein 121 (.1)		Potri.004G118000 [exp]	38.67	0.6818

Compare expression of checked genes

Potri.017G153200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.