Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1) AT1G73260 151 / 8e-46 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1) AT1G73325 105 / 3e-28 Kunitz family trypsin and protease inhibitor protein (.1) AT1G73330 83 / 2e-19 ATDR4 drought-repressed 4 (.1) AT1G72290 50 / 1e-07 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G153600 [exp] 392 / 3e-141 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153466 [exp] 389 / 5e-140 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067600 [exp] 264 / 2e-90 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067900 [exp] 233 / 3e-78 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1) Potri.017G153200 [exp] 215 / 3e-71 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G067800 [exp] 166 / 1e-51 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1) Potri.004G000400 [exp] 96 / 1e-24 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1) Potri.019G006900 [exp] 94 / 6e-24 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1) Potri.001G309900 [exp] 90 / 2e-22 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039163 [exp] 218 / 8e-72 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007889 [exp] 216 / 2e-71 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013770 [exp] 216 / 4e-71 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007890 [exp] 213 / 7e-70 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1) Lus10039210 [exp] 212 / 7e-70 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1) Lus10030354 [exp] 211 / 5e-69 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007892 [exp] 209 / 2e-68 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10007902 [exp] 209 / 2e-68 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1) Lus10026357 [exp] 207 / 1e-67 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1) Lus10013730 [exp] 206 / 1e-67 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0066 [poplar] [flax] Trefoil PF00197 [poplar] [flax] Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence Show only first row Show all	>Potri.017G153400.1 pacid=42813048 polypeptide=Potri.017G153400.1.p locus=Potri.017G153400 ID=Potri.017G153400.1.v4.1 annot-version=v4.1 ATGAGAGCTGCAATTCTAGCATTGTCCTTCCTTCTTTTTGCCTTAGCTGCAAATCAATATTTGCCTAGGGTAGCAGCTACTGCTGCCCCTGAGCCAGTGC TCGACGTCACCGGTAAGATACTTAGAACCGGCACTAGCTACTACATCCTGCCGGTGATCCGTGGGAGAGGTGGTGGGCTCAAAATGGCTAGCACTGTAAG AAGAACCTGCCCACTTGATGTTGTCCAGGACCGATATGAGGCATCAAATGGTCTCCCACTGAAATTCACACCTGTGAACACCAAGAAAGGCGTCGTCCGC GTCCACACCGATCTTAACATAAGATTCTCTGCTGCATCAATCTGTCACCAGTCAACAGCGTGGAAGCTTGACAACTATGATGAATGGACAAAACAATGGT TTGTCACAACCGATGGAGTTGAAGGAAATCCTGGTCCGCAAACAACAAACAACTGGTTCAAGATTGAGAAGTTCGAAGACAAGTACAAGCTAGTTTTTTG CCCTACAGTGTGTCAACACTGCAAAGTTATGTGCAAAGATATCGGGATTTATGTTGATGCCAAAGGAGTAAGGCGCCTGGCTCTTACCAACGTGCCTCTC AAAGTTATGTTCAAGAAGGCTTGA
AA sequence Show only first row Show all	>Potri.017G153400.1 pacid=42813048 polypeptide=Potri.017G153400.1.p locus=Potri.017G153400 ID=Potri.017G153400.1.v4.1 annot-version=v4.1 MRAAILALSFLLFALAANQYLPRVAATAAPEPVLDVTGKILRTGTSYYILPVIRGRGGGLKMASTVRRTCPLDVVQDRYEASNGLPLKFTPVNTKKGVVR VHTDLNIRFSAASICHQSTAWKLDNYDEWTKQWFVTTDGVEGNPGPQTTNNWFKIEKFEDKYKLVFCPTVCQHCKVMCKDIGIYVDAKGVRRLALTNVPL KVMFKKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17860			Kunitz family trypsin and prot...		Potri.017G153400 [exp]	0	1
AT1G17860			Kunitz family trypsin and prot...		Potri.017G153600 [exp]	2.82	0.9702
AT1G17860			Kunitz family trypsin and prot...		Potri.017G153466 [exp]	3.00	0.9842
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120600 [exp]	12.64	0.8894
AT5G58240		FHIT	FRAGILE HISTIDINE TRIAD (.1.2)		Potri.013G161100 [exp]	21.97	0.8983
AT2G21045			Rhodanese/Cell cycle control p...		Potri.014G131300 [exp]	22.02	0.9164
AT5G35370			S-locus lectin protein kinase ...		Potri.019G013797 [exp]	28.24	0.8748
AT5G50300		ATAZG2	ARABIDOPSIS THALIANA AZA-GUANI...		Potri.015G090000 [exp]	34.72	0.9000
AT3G22060			Receptor-like protein kinase-r...		Potri.007G120601 [exp]	34.89	0.8692
AT5G05340			Peroxidase superfamily protein...		Potri.013G154400 [exp]	34.95	0.8551	Pt-PRX1.9
AT1G05660			Pectin lyase-like superfamily ...		Potri.017G006400 [exp]	35.28	0.8786

Compare expression of checked genes

Potri.017G153400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.