Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54540 243 / 1e-80 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G36970 233 / 6e-77 NHL25 NDR1/HIN1-like 25 (.1) AT1G65690 212 / 1e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G27080 112 / 2e-29 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT5G21130 107 / 1e-27 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35980 66 / 2e-12 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 65 / 2e-12 NHL2 NDR1/HIN1-like 2 (.1) AT5G53730 65 / 2e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35460 65 / 3e-12 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G22870 63 / 1e-11 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G067100 [exp] 375 / 2e-132 AT1G54540 203 / 3e-65 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G148200 [exp] 224 / 4e-73 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.012G145500 [exp] 213 / 1e-68 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.009G158900 [exp] 142 / 5e-41 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.013G135800 [exp] 137 / 3e-39 AT1G65690 112 / 4e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G197600 [exp] 126 / 9e-35 AT2G27080 264 / 8e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.019G102500 [exp] 90 / 4e-22 AT1G65690 78 / 9e-18 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.003G039400 [exp] 83 / 1e-18 AT1G17620 208 / 1e-66 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G003800 [exp] 81 / 2e-18 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031888 [exp] 258 / 1e-86 AT1G54540 236 / 2e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031317 [exp] 258 / 2e-86 AT1G54540 231 / 1e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007364 [exp] 206 / 1e-65 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020783 [exp] 179 / 1e-55 AT5G36970 229 / 2e-75 NDR1/HIN1-like 25 (.1) Lus10033705 [exp] 93 / 3e-22 AT1G65690 114 / 1e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031635 [exp] 86 / 1e-19 AT1G65690 101 / 9e-26 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10037638 [exp] 82 / 3e-18 AT1G17620 201 / 4e-64 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10015622 [exp] 80 / 2e-17 AT1G17620 196 / 5e-62 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10003824 [exp] 72 / 2e-14 AT1G17620 191 / 5e-60 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10026428 [exp] 62 / 5e-11 AT5G11890 209 / 7e-67 EMBRYO DEFECTIVE 3135, unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.017G154000.1 pacid=42813462 polypeptide=Potri.017G154000.1.p locus=Potri.017G154000 ID=Potri.017G154000.1.v4.1 annot-version=v4.1 ATGGAAAAAACAAGAACGCAGATGACGGGAGATAAGCCGAAAATTCATCCAGCAGTAGATGTTGAAGCACCACCACCAACAGCACCGTTGATATCTCGAG GCTTGGCAACATCCGAAAAGGGTGGTTCGAGTCAGAGTCAGCAGCAACCTCCACTGCCATTACGCACCATGCCAGCAGCTATGCAGTCTAGTAAACCACA AAAGACAAGAAGCTGTTGTTGCAAGTGCGTATGTTGGACCGTAGGTCTACTTGTCCTGCTATTAGTTATTGTCGGAGCCACTGCCGGCATTCTTTACCTG GTCTTCAAACCAAAAATTCCCAACTACTCTGTTGATAGTTTGAGCATAAGTGACCTGAGGCTCAACTTTGATATGTCCCTATATGCTAAATTTGATGTGA AGATCACAGCCAATAACCCCAACAAGAAAATTGGAATTTACTACGAGAAAGGTGGGCTCTTGAGTGTGTGGTACACAAACACTAAGCTCTGTGCAGGTTC AATACCAAAATTCTACCAAGGTCACCAGAACATAACAAAACTGGATGTGAGCTTAACGGGGCAAACACAGTACGGAAGCACTTTATTGAGGGCATTGCAA GAGCAACAACAAACAGGACGTATTCCATTAGATCTTAAAGTTGATGCACCAGTTTCTATCAAACTTGGTAGGTTGAAGCTGAGGAAGGTGACGATCTTGG GGGATTGTTTGTTGGTGGTAGATAGCTTATCTACCAACAATCTAATCAGCATCAAAGCTAGTAATTGCAGGTTTAAATTAAAGCTTTGA
AA sequence Show only first row Show all	>Potri.017G154000.1 pacid=42813462 polypeptide=Potri.017G154000.1.p locus=Potri.017G154000 ID=Potri.017G154000.1.v4.1 annot-version=v4.1 MEKTRTQMTGDKPKIHPAVDVEAPPPTAPLISRGLATSEKGGSSQSQQQPPLPLRTMPAAMQSSKPQKTRSCCCKCVCWTVGLLVLLLVIVGATAGILYL VFKPKIPNYSVDSLSISDLRLNFDMSLYAKFDVKITANNPNKKIGIYYEKGGLLSVWYTNTKLCAGSIPKFYQGHQNITKLDVSLTGQTQYGSTLLRALQ EQQQTGRIPLDLKVDAPVSIKLGRLKLRKVTILGDCLLVVDSLSTNNLISIKASNCRFKLKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G54540			Late embryogenesis abundant (L...		Potri.017G154000 [exp]	0	1
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Potri.007G114375 [exp]	1.73	0.9719
AT4G35160			O-methyltransferase family pro...		Potri.011G059500 [exp]	3.46	0.9690	Pt-OOMT2.14,FOMT7
AT5G20230		SAG14, ATBCB	SENESCENCE ASSOCIATED GENE 14,...		Potri.018G129400 [exp]	5.00	0.9640
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Potri.007G114700 [exp]	6.00	0.9644
					Potri.017G047100 [exp]	6.92	0.9690
AT4G33440			Pectin lyase-like superfamily ...		Potri.005G063400 [exp]	7.00	0.9141
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.017G134151 [exp]	10.58	0.9411
AT5G17430	AP2_ERF	BBM	BABY BOOM, Integrase-type DNA-...		Potri.008G076400 [exp]	10.81	0.9525
AT5G57620	MYB	ATMYB36	myb domain protein 36 (.1)		Potri.009G007100 [exp]	10.95	0.9418
AT1G48930		ATGH9C1	glycosyl hydrolase 9C1 (.1)		Potri.007G071200 [exp]	11.09	0.9193

Compare expression of checked genes

Potri.017G154000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.