Potri.017G154100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05070 100 / 1e-28 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G067300 108 / 8e-32 AT3G05070 149 / 8e-47 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026367 95 / 2e-26 AT3G05070 198 / 3e-66 unknown protein
Lus10042290 94 / 3e-26 AT3G05070 190 / 4e-63 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08315 cwf18 cwf18 pre-mRNA splicing factor
Representative CDS sequence
>Potri.017G154100.1 pacid=42813224 polypeptide=Potri.017G154100.1.p locus=Potri.017G154100 ID=Potri.017G154100.1.v4.1 annot-version=v4.1
ATGAAGTTTCGAAATTATGTTCCTCAAGACAAGGAGTTTCATGAGGGTAAGCTTGCTCCGCCAGATCCATTTCTCAACATTGCTCCAAAGAAGCCAAACT
GGGACCTGCGAAGAGATGTGCAGAAGAAGCACGATAAGCTTGAAAGACGTACACTGAAGGCAATATGTAAACTTATGGAGGAACAAGAAAAAGAAAAGCA
AGTGGTTGAGAATGGTGGCAATGTTATTGAAGATTAG
AA sequence
>Potri.017G154100.1 pacid=42813224 polypeptide=Potri.017G154100.1.p locus=Potri.017G154100 ID=Potri.017G154100.1.v4.1 annot-version=v4.1
MKFRNYVPQDKEFHEGKLAPPDPFLNIAPKKPNWDLRRDVQKKHDKLERRTLKAICKLMEEQEKEKQVVENGGNVIED

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G05070 unknown protein Potri.017G154100 0 1
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G025000 23.95 0.7956
AT3G51030 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOX... Potri.005G232650 25.61 0.7956
AT5G62550 unknown protein Potri.016G129250 28.63 0.7956
AT5G23660 MTN3, SWEET12, ... homolog of Medicago truncatula... Potri.015G101700 30.39 0.7944
AT5G50400 ATPAP27, PAP27 ARABIDOPSIS THALIANA PURPLE AC... Potri.003G202200 33.22 0.7917
AT5G02070 Protein kinase family protein ... Potri.013G011700 34.58 0.7902
AT5G13170 SAG29, SWEET15,... senescence-associated gene 29 ... Potri.001G060900 37.94 0.7761
AT5G38760 Late embryogenesis abundant pr... Potri.004G107500 39.94 0.7740
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.019G020367 41.02 0.7747
Potri.018G128750 43.71 0.7664

Potri.017G154100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.