Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-BETA-TIP.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17810 372 / 1e-131 BETA-TIP beta-tonoplast intrinsic protein (.1) AT1G73190 361 / 4e-127 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT2G36830 271 / 8e-92 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT4G01470 260 / 2e-87 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT3G26520 259 / 4e-87 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT3G16240 243 / 6e-81 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT4G17340 224 / 2e-73 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT5G47450 222 / 2e-72 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT2G25810 222 / 2e-72 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT3G47440 166 / 2e-50 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G152100 [exp] 424 / 5e-152 AT1G17810 350 / 8e-123 beta-tonoplast intrinsic protein (.1) Potri.008G050700 [exp] 278 / 1e-94 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.010G209900 [exp] 277 / 4e-94 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.006G121700 [exp] 274 / 8e-93 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.016G098200 [exp] 272 / 5e-92 AT2G36830 354 / 1e-124 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.009G005400 [exp] 249 / 5e-83 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.009G027200 [exp] 248 / 2e-82 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1) Potri.001G235300 [exp] 247 / 2e-82 AT4G01470 375 / 8e-133 tonoplast intrinsic protein 1;3 (.1) Potri.004G216500 [exp] 245 / 1e-81 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036187 [exp] 404 / 5e-144 AT1G73190 382 / 4e-135 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) Lus10038324 [exp] 402 / 2e-143 AT1G73190 380 / 1e-134 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) Lus10018256 [exp] 390 / 2e-138 AT1G17810 370 / 7e-131 beta-tonoplast intrinsic protein (.1) Lus10040652 [exp] 385 / 7e-137 AT1G17810 367 / 2e-129 beta-tonoplast intrinsic protein (.1) Lus10023913 [exp] 275 / 4e-93 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10014411 [exp] 273 / 2e-92 AT2G36830 390 / 4e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10022611 [exp] 269 / 6e-91 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10021510 [exp] 269 / 7e-91 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10005885 [exp] 267 / 5e-90 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10040863 [exp] 262 / 3e-88 AT4G01470 394 / 2e-140 tonoplast intrinsic protein 1;3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [poplar] [flax] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Potri.017G154800.1 pacid=42812901 polypeptide=Potri.017G154800.1.p locus=Potri.017G154800 ID=Potri.017G154800.1.v4.1 annot-version=v4.1 ATGCCTCGCAGACATGCATTTGGGAGGGCTGATGAGGCCACCCACCCCGACTCCATGAGAGCCGCTTTGGCTGAATTTGTCTCCACTTTCGTCTTTGTTT TTGCTGGAGAAGGCTCTGTCCTTGCTCTTGACAAGTTGTACAAGGAAACCGGGCCACTGGCTTCCGGGCTCGTAGTGGTTGCACTTGCACATGCATTGGC ACTGTTTTCCGCTGTGGCATCCAGCATCAACATATCAGGTGGCCATGTAAACCCTGCTGTTACCTTCGGCTCACTTGTCGGTGGCAGGATATCGGTTATT CGAGCTGTCTATTATTGGGTTGCCCAGCTCTTGGGTTCTATTGTAGCAGCTCTCTTGTTGAGGCTTGTCACCAATGGCATGAGACCAGTAGGGTTCCATG TGCAGTCAGGAGTTGGAGAGGTGCATGGGCTTCTAATGGAAATGGCACTGACATTTGGAGTGGTTTACACAGTGTATGCAACAGCCCTTGATCCTAAAAG GGGAAGCTTGGGGATCATTGCACCTCTAGCAATTGGGTTCATTGTGGGGGCAAATATCTTGGTTGGTGGTCCGTTTGATGGGGCCTCTATGAACCCAGCA AGAGCTTTTGGGCCTGCTTTAATTGGGTGGAGATGGAGAAACCATTGGATATACTGGGTTGGTCCTTTCCTTGGAGGAGGCTTGGCAGCACTCATATATG AATACATTGTGATCCCCACAGAGCCAGTACCTCGCCATGCTCATCAACATCAGCCCCTGGCTCCTGAAGACTATTAG
AA sequence Show only first row Show all	>Potri.017G154800.1 pacid=42812901 polypeptide=Potri.017G154800.1.p locus=Potri.017G154800 ID=Potri.017G154800.1.v4.1 annot-version=v4.1 MPRRHAFGRADEATHPDSMRAALAEFVSTFVFVFAGEGSVLALDKLYKETGPLASGLVVVALAHALALFSAVASSINISGGHVNPAVTFGSLVGGRISVI RAVYYWVAQLLGSIVAALLLRLVTNGMRPVGFHVQSGVGEVHGLLMEMALTFGVVYTVYATALDPKRGSLGIIAPLAIGFIVGANILVGGPFDGASMNPA RAFGPALIGWRWRNHWIYWVGPFLGGGLAALIYEYIVIPTEPVPRHAHQHQPLAPEDY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17810		BETA-TIP	beta-tonoplast intrinsic prote...		Potri.017G154800 [exp]	0	1	Pt-BETA-TIP.2
					Potri.001G355650 [exp]	17.05	0.7966
AT3G18680			Amino acid kinase family prote...		Potri.007G110201 [exp]	23.06	0.7784
					Potri.004G169000 [exp]	30.78	0.7564
					Potri.008G113500 [exp]	46.31	0.7426
					Potri.005G078050 [exp]	49.74	0.5853
AT2G02955		MEE12	maternal effect embryo arrest ...		Potri.010G169500 [exp]	50.01	0.7514
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Potri.011G085000 [exp]	53.55	0.7462	LCOSC2.5
AT4G33380			unknown protein		Potri.002G127700 [exp]	56.44	0.7135
AT5G14710			unknown protein		Potri.001G349500 [exp]	66.52	0.7405
AT2G06000			Pentatricopeptide repeat (PPR)...		Potri.006G141800 [exp]	75.71	0.6926

Compare expression of checked genes

Potri.017G154800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.