Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16130 171 / 1e-50 WAKL2 wall associated kinase-like 2 (.1) AT1G16160 168 / 9e-50 WAKL5 wall associated kinase-like 5 (.1) AT1G16110 167 / 2e-49 WAKL6 wall associated kinase-like 6 (.1) AT1G16260 167 / 2e-49 Wall-associated kinase family protein (.1.2) AT1G16150 166 / 1e-48 WAKL4 wall associated kinase-like 4 (.1) AT1G16120 165 / 1e-48 WAKL1 wall associated kinase-like 1 (.1) AT1G79680 162 / 1e-47 ATWAKL10 WALL ASSOCIATED KINASE (WAK)-LIKE 10 (.1) AT1G79670 161 / 2e-47 WAKL22, RFO1 RESISTANCE TO FUSARIUM OXYSPORUM 1, Wall-associated kinase family protein (.1.2) AT1G19390 160 / 1e-46 Wall-associated kinase family protein (.1) AT4G31100 159 / 2e-46 wall-associated kinase, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G185622 [exp] 185 / 5e-56 AT1G16260 551 / 0.0 Wall-associated kinase family protein (.1.2) Potri.003G185700 [exp] 183 / 2e-55 AT1G16260 622 / 0.0 Wall-associated kinase family protein (.1.2) Potri.001G040000 [exp] 182 / 4e-55 AT1G79670 604 / 0.0 RESISTANCE TO FUSARIUM OXYSPORUM 1, Wall-associated kinase family protein (.1.2) Potri.003G185688 [exp] 182 / 6e-55 AT1G16260 615 / 0.0 Wall-associated kinase family protein (.1.2) Potri.001G040756 [exp] 174 / 1e-54 AT1G69730 448 / 3e-152 Wall-associated kinase family protein (.1) Potri.001G041012 [exp] 176 / 1e-53 AT1G79670 501 / 6e-171 RESISTANCE TO FUSARIUM OXYSPORUM 1, Wall-associated kinase family protein (.1.2) Potri.003G185732 [exp] 176 / 1e-53 AT1G17910 446 / 8e-150 Wall-associated kinase family protein (.1) Potri.004G192300 [exp] 173 / 1e-53 AT1G16130 422 / 4e-142 wall associated kinase-like 2 (.1) Potri.003G186200 [exp] 177 / 3e-53 AT1G79680 510 / 2e-172 WALL ASSOCIATED KINASE (WAK)-LIKE 10 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034085 [exp] 155 / 3e-45 AT1G16130 526 / 5e-179 wall associated kinase-like 2 (.1) Lus10003063 [exp] 154 / 1e-44 AT1G16130 514 / 2e-173 wall associated kinase-like 2 (.1) Lus10013143 [exp] 142 / 1e-42 AT1G16160 270 / 2e-85 wall associated kinase-like 5 (.1) Lus10004504 [exp] 145 / 1e-41 AT1G16130 411 / 5e-134 wall associated kinase-like 2 (.1) Lus10038077 [exp] 140 / 1e-39 AT1G21270 576 / 0.0 wall-associated kinase 2 (.1) Lus10008105 [exp] 137 / 2e-38 AT1G16120 419 / 3e-137 wall associated kinase-like 1 (.1) Lus10014387 [exp] 120 / 9e-33 AT5G02070 493 / 8e-168 Protein kinase family protein (.1) Lus10013040 [exp] 119 / 5e-32 AT1G70530 788 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 (.1) Lus10013384 [exp] 118 / 1e-31 AT1G21270 430 / 3e-140 wall-associated kinase 2 (.1) Lus10013385 [exp] 117 / 3e-31 AT1G21270 437 / 2e-143 wall-associated kinase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.018G000301.1 pacid=42801854 polypeptide=Potri.018G000301.1.p locus=Potri.018G000301 ID=Potri.018G000301.1.v4.1 annot-version=v4.1 ATGGTTAAATTGCTAGGATGTTGTTTAGAGACTGAAGTTCCTCTCATTGTCTATGAATTCATTCCCAACAAAAATCTTTATAGGCATCTCCATGTTCAAA ACAATGATTTCTCATTATCTTGGGAAAGGCGATTATGGATTGCTATAGAGGTTACGGAAGCCCTTTCCTATTTACACTCAAAAGCATCCATTCAGATATA TCACCGAGATATTAAGTCTACGAACATACTTAACATACTTATAGACGAGGAATATATAGCCAAAATATCTTATTTCGGAACTTCAAGAGCCATAGCCATC AATCAAACTCACTTGACCACTCAAGTGAAAGTTACCTTAGGCTACTTTGTTTCGGAGTACTTCCGATCCGGTCCATATACAGAAAAAAAGTGA
AA sequence Show only first row Show all	>Potri.018G000301.1 pacid=42801854 polypeptide=Potri.018G000301.1.p locus=Potri.018G000301 ID=Potri.018G000301.1.v4.1 annot-version=v4.1 MVKLLGCCLETEVPLIVYEFIPNKNLYRHLHVQNNDFSLSWERRLWIAIEVTEALSYLHSKASIQIYHRDIKSTNILNILIDEEYIAKISYFGTSRAIAI NQTHLTTQVKVTLGYFVSEYFRSGPYTEKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G16130		WAKL2	wall associated kinase-like 2 ...		Potri.018G000301 [exp]	0	1
AT1G68050		ADO3, FKF1	"flavin-binding, kelch repeat,...		Potri.010G105700 [exp]	25.92	0.6792	FKF1.1
AT4G37940	MADS	AGL21	AGAMOUS-like 21 (.1)		Potri.001G284301 [exp]	33.13	0.6740
AT4G37940	MADS	AGL21	AGAMOUS-like 21 (.1)		Potri.001G284600 [exp]	46.73	0.6340
AT4G09020		ATISA3, ISA3	isoamylase 3 (.1)		Potri.002G100900 [exp]	52.74	0.6613
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Potri.001G432400 [exp]	94.58	0.5659
AT5G39040		AtALS1, ABCB27,...	ARABIDOPSIS THALIANA TRANSPORT...		Potri.016G106650 [exp]	116.89	0.6024
					Potri.006G019650 [exp]	142.30	0.5444
AT4G27220			NB-ARC domain-containing disea...		Potri.005G062130 [exp]	148.74	0.5560
AT3G29320		PHS1	alpha-glucan phosphorylase 1, ...		Potri.004G123600 [exp]	188.87	0.5659	PHO1.2
AT3G23340		CKL10	casein kinase I-like 10 (.1)		Potri.010G070400 [exp]	194.29	0.5629

Compare expression of checked genes

Potri.018G000301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.