Potri.018G003000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G24390 191 / 8e-63 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3)
AT4G31310 187 / 2e-61 AIG2-like (avirulence induced gene) family protein (.1)
AT5G39730 147 / 2e-45 AIG2-like (avirulence induced gene) family protein (.1)
AT3G28940 140 / 6e-43 AIG2-like (avirulence induced gene) family protein (.1)
AT3G28930 138 / 7e-42 AIG2 AVRRPT2-INDUCED GENE 2, AIG2-like (avirulence induced gene) family protein (.1)
AT5G39720 137 / 2e-41 AIG2L avirulence induced gene 2 like protein (.1)
AT3G28950 137 / 2e-41 AIG2-like (avirulence induced gene) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G278900 308 / 5e-109 AT2G24390 194 / 4e-64 AIG2-like (avirulence induced gene) family protein (.1), AIG2-like (avirulence induced gene) family protein (.2), AIG2-like (avirulence induced gene) family protein (.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026984 181 / 2e-56 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10020179 134 / 1e-40 AT4G31310 115 / 2e-33 AIG2-like (avirulence induced gene) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0278 AIG2 PF06094 GGACT Gamma-glutamyl cyclotransferase, AIG2-like
Representative CDS sequence
>Potri.018G003000.1 pacid=42800497 polypeptide=Potri.018G003000.1.p locus=Potri.018G003000 ID=Potri.018G003000.1.v4.1 annot-version=v4.1
ATGGCAATGGTAGGAGGCAATCAGGTCCACAACGTGTTCGTGTATGGAAGCCTTCTTGCTGATGACGTTGTTCGTGCCCTCTTGAGCCGCATCCCTCAAT
CTTCTCCAGCCATCCTCAACGGCCATCACAGGTTTAGCATAAAAGGGCGCGTCTACCCTGCAATTCTACCTGTGGAGAACAAGGAAGTTACTGGAAAGGT
TCTCCAGGGCATCACTGATCTGGAATTGTATATTTTAGATGAATTTGAGGACGTTGAATATGAAAGAGTCACTGTTGATGTTTCTTTGATGGACTCATCT
AACAAGTCACAAGCATTTGCTTATGTTTGGTCAGACAAGAATGATCCCAACTTGTACGGGGAGTGGGATTTTGAGGAATGGAAGAGGACTCAGATGTCGG
ATTTCGTCAAGATGTCTGCTGAATTTAGGAAAGATCTAGAGCTGCCCGAGTCGAAGACAAGAATAGCCACTTACGAATCCTACTATCAGCAGGATGGCAG
CGACAGTCCCCTCGCCCCCTGA
AA sequence
>Potri.018G003000.1 pacid=42800497 polypeptide=Potri.018G003000.1.p locus=Potri.018G003000 ID=Potri.018G003000.1.v4.1 annot-version=v4.1
MAMVGGNQVHNVFVYGSLLADDVVRALLSRIPQSSPAILNGHHRFSIKGRVYPAILPVENKEVTGKVLQGITDLELYILDEFEDVEYERVTVDVSLMDSS
NKSQAFAYVWSDKNDPNLYGEWDFEEWKRTQMSDFVKMSAEFRKDLELPESKTRIATYESYYQQDGSDSPLAP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G24390 AIG2-like (avirulence induced ... Potri.018G003000 0 1
AT1G53670 MSRB1, ATMSRB1 methionine sulfoxide reductase... Potri.011G114300 3.46 0.9404
AT4G28740 unknown protein Potri.014G194500 5.09 0.9506
AT5G61820 unknown protein Potri.015G108600 8.36 0.9315
AT5G59030 COPT1 copper transporter 1 (.1) Potri.009G038800 10.58 0.9328 COPT1.2
AT3G01060 unknown protein Potri.017G090100 13.41 0.9442
AT1G06110 SKIP16 SKP1/ASK-interacting protein 1... Potri.015G078100 14.66 0.9429
AT1G42970 GAPB glyceraldehyde-3-phosphate deh... Potri.005G254100 14.96 0.9437 Pt-GAPB.2
AT2G36895 unknown protein Potri.016G099300 15.19 0.9186
AT4G03280 PGR1, PETC PROTON GRADIENT REGULATION 1, ... Potri.019G118500 16.30 0.9450 PETC.1
AT2G16800 high-affinity nickel-transport... Potri.009G135600 23.23 0.9046

Potri.018G003000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.