Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14470 43 / 5e-06 NB-ARC domain-containing disease resistance protein (.1) AT3G46730 41 / 4e-05 NB-ARC domain-containing disease resistance protein (.1) AT1G50180 38 / 0.0005 NB-ARC domain-containing disease resistance protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G121800 [exp] 101 / 2e-26 AT3G14470 377 / 3e-114 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121750 [exp] 97 / 5e-25 AT3G14470 338 / 8e-103 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123500 [exp] 97 / 1e-24 AT3G14470 395 / 4e-121 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122900 [exp] 96 / 1e-24 AT3G14470 414 / 6e-129 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121801 [exp] 95 / 3e-24 AT3G14470 410 / 3e-127 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121876 [exp] 94 / 9e-24 AT3G14470 404 / 6e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.012G122200 [exp] 93 / 2e-23 AT3G14470 411 / 2e-127 NB-ARC domain-containing disease resistance protein (.1) Potri.012G123200 [exp] 91 / 9e-23 AT3G14470 407 / 1e-125 NB-ARC domain-containing disease resistance protein (.1) Potri.012G121900 [exp] 87 / 3e-21 AT3G14470 399 / 2e-122 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022792 [exp] 85 / 2e-20 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Lus10022900 [exp] 83 / 6e-20 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10029704 [exp] 79 / 4e-19 AT3G14470 92 / 7e-21 NB-ARC domain-containing disease resistance protein (.1) Lus10003571 [exp] 80 / 1e-18 AT3G14470 363 / 6e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10002609 [exp] 77 / 8e-18 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1) Lus10004126 [exp] 72 / 7e-16 AT3G14470 353 / 6e-106 NB-ARC domain-containing disease resistance protein (.1) Lus10004127 [exp] 72 / 7e-16 AT3G14470 350 / 5e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10006794 [exp] 52 / 8e-09 AT3G14470 264 / 2e-78 NB-ARC domain-containing disease resistance protein (.1) Lus10042117 [exp] 49 / 5e-08 AT3G14470 354 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10039540 [exp] 49 / 1e-07 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G003502.1 pacid=42800472 polypeptide=Potri.018G003502.1.p locus=Potri.018G003502 ID=Potri.018G003502.1.v4.1 annot-version=v4.1 ATGGAGCAGCTGAGCTTAATGCTTGCTCAGGAGGTGCAACAGGAAGTGAGGCTCGTTGTTGGTGTCAAGAACGAGGTTAAAAAGCTTACCAGCAATTTCC AGGCCATCCAAGATGTGCTTGCCGATGCAGAGGAAAGACAGTTGAAGGATGGCTCCATCAAACGTTGGATAGATCAGCTCAAAGGCGTATCTTATGATAT GGATGATGTTCTGGATGAGTGGGGCACGTCAATTGCAAAATCACAAATGAAGGTAAATGAGCATCCCCGCAAGACTGCTAGGAAGGCGCCTCACTAA
AA sequence Show only first row Show all	>Potri.018G003502.1 pacid=42800472 polypeptide=Potri.018G003502.1.p locus=Potri.018G003502 ID=Potri.018G003502.1.v4.1 annot-version=v4.1 MEQLSLMLAQEVQQEVRLVVGVKNEVKKLTSNFQAIQDVLADAEERQLKDGSIKRWIDQLKGVSYDMDDVLDEWGTSIAKSQMKVNEHPRKTARKAPH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14470			NB-ARC domain-containing disea...		Potri.018G003502 [exp]	0	1
AT2G32940		AGO6	ARGONAUTE 6, Argonaute family ...		Potri.014G159400 [exp]	1.00	0.9064	AGO902
AT5G13960		SDG33, KYP, SUV...	SET DOMAIN PROTEIN 33, KRYPTON...		Potri.003G162801 [exp]	2.44	0.8657
AT1G48050		KU80, ATKU80	ARABIDOPSIS THALIANA KU80 HOMO...		Potri.002G148200 [exp]	5.47	0.8198
AT1G28760			Uncharacterized conserved prot...		Potri.019G039300 [exp]	9.16	0.7454
AT5G48920		TED7	tracheary element differentiat...		Potri.005G060700 [exp]	24.73	0.7272
AT5G07280		EXS, EMS1	EXTRA SPOROGENOUS CELLS, EXCES...		Potri.012G139000 [exp]	25.78	0.7319	EMS1.2
					Potri.003G151900 [exp]	30.29	0.7611
AT3G12890		ASML2	activator of spomin::LUC2 (.1)		Potri.001G136700 [exp]	30.51	0.8188
AT4G31810			ATP-dependent caseinolytic (Cl...		Potri.006G264200 [exp]	35.87	0.7328
AT2G17450		RHA3A	RING-H2 finger A3A (.1)		Potri.007G057300 [exp]	38.39	0.7011

Compare expression of checked genes

Potri.018G003502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.