Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10695 102 / 7e-31 unknown protein AT5G57123 89 / 3e-25 unknown protein AT4G29905 80 / 5e-22 unknown protein AT1G52855 48 / 4e-09 unknown protein AT2G20835 46 / 2e-08 unknown protein AT3G15534 46 / 2e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G140500 [exp] 96 / 5e-28 AT5G57123 99 / 1e-29 unknown protein Potri.006G073400 [exp] 96 / 5e-28 AT5G57123 97 / 8e-29 unknown protein Potri.010G251000 [exp] 61 / 4e-14 AT5G10695 39 / 1e-05 unknown protein Potri.008G007932 [exp] 54 / 1e-11 AT4G29905 54 / 1e-11 unknown protein Potri.008G007800 [exp] 54 / 2e-11 AT4G29905 54 / 1e-11 unknown protein Potri.019G104300 [exp] 49 / 1e-09 AT1G52855 116 / 2e-36 unknown protein Potri.019G104100 [exp] 49 / 1e-09 AT1G52855 116 / 2e-36 unknown protein Potri.001G405400 [exp] 46 / 2e-08 AT1G52855 85 / 9e-24 unknown protein Potri.013G145100 [exp] 45 / 7e-08 AT1G52855 112 / 2e-34 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026229 [exp] 117 / 1e-36 AT5G10695 107 / 1e-32 unknown protein Lus10042440 [exp] 117 / 1e-36 AT5G10695 107 / 1e-32 unknown protein Lus10039793 [exp] 48 / 5e-09 AT2G20835 115 / 7e-36 unknown protein Lus10018561 [exp] 45 / 4e-08 AT2G20835 111 / 2e-34 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G007300.1 pacid=42801588 polypeptide=Potri.018G007300.1.p locus=Potri.018G007300 ID=Potri.018G007300.1.v4.1 annot-version=v4.1 ATGTGCTTGGTATTTGTGTGTGATGAGGATGAGAAGGTGGTAGCAAGGCAAACAGCACCTGGGGCATGTCCATACTGTGGAGGGGCGATTCAAGCCATGG ATGTAGAGAGCCAGTGGAGGTTTTGCTTCTTGCCTCTATATTTCAAGACGAAGAAGAGATATTATTGCACTCTGTGTGCTAGAAAATTAGCTGTCCAGTC GTAA
AA sequence Show only first row Show all	>Potri.018G007300.1 pacid=42801588 polypeptide=Potri.018G007300.1.p locus=Potri.018G007300 ID=Potri.018G007300.1.v4.1 annot-version=v4.1 MCLVFVCDEDEKVVARQTAPGACPYCGGAIQAMDVESQWRFCFLPLYFKTKKRYYCTLCARKLAVQS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G10695			unknown protein		Potri.018G007300 [exp]	0	1
AT2G30360		PKS5, CIPK11, S...	SNF1-RELATED PROTEIN KINASE 3....		Potri.019G128100 [exp]	1.00	0.8249	PKS5.2
AT5G54165			unknown protein		Potri.015G004800 [exp]	3.16	0.7638
AT3G26922			F-box/RNI-like superfamily pro...		Potri.011G104100 [exp]	4.24	0.8039
AT5G04750			F1F0-ATPase inhibitor protein,...		Potri.010G240401 [exp]	4.24	0.7921
AT4G33920			Protein phosphatase 2C family ...		Potri.009G091600 [exp]	6.92	0.7613
AT5G49230		HRB1	HYPERSENSITIVE TO RED AND BLUE...		Potri.008G213400 [exp]	7.48	0.7714
					Potri.014G134750 [exp]	8.12	0.7637
AT4G12040		AtSAP7	stress-associated protein 7, A...		Potri.001G115000 [exp]	10.58	0.7442
AT2G23780			RING/U-box superfamily protein...		Potri.005G127900 [exp]	16.00	0.7414
AT3G56830			Protein of unknown function (D...		Potri.002G146000 [exp]	16.12	0.7816

Compare expression of checked genes

Potri.018G007300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.