Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61566 58 / 8e-13 RALFL9 ralf-like 9 (.1) AT2G32835 50 / 1e-09 RALFL16 RALF-like 16 (.1) AT2G22055 45 / 1e-07 RALFL15 RALF-like 15 (.1) AT1G60815 44 / 2e-07 RALFL7 RALF-like 7 (.1) AT1G60625 41 / 4e-06 RALFL6 RALF-like 6 (.1) AT4G11510 38 / 5e-05 RALFL28 ralf-like 28 (.1) AT1G61563 38 / 6e-05 RALFL8 ralf-like 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G007701 [exp] 130 / 2e-41 AT1G61566 58 / 6e-13 ralf-like 9 (.1) Potri.018G007800 [exp] 104 / 3e-31 AT2G32835 51 / 6e-10 RALF-like 16 (.1) Potri.018G007600 [exp] 101 / 4e-30 AT1G61566 50 / 8e-10 ralf-like 9 (.1) Potri.019G102400 [exp] 36 / 0.0003 AT1G23145 50 / 2e-09 RALF-like 2 (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [poplar] [flax] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Potri.018G007500.1 pacid=42801838 polypeptide=Potri.018G007500.1.p locus=Potri.018G007500 ID=Potri.018G007500.1.v4.1 annot-version=v4.1 ATGTCTCCCTCAAACAAGTTGATGGCTTTGGGGCTTTGCATGCTGATGGCATGCACTCTTTTTGCAGGAAATGCAGAGGCGACTAGAGATATTAATTATG GAGCTATCGTTAAAGGTGATCACGAACCCTTCTGTGGCCCAACACATCCATGTGTGAAGACACCTGCAAATGGGTACCATAGAGGTTGCGAAACAATTAA TAAGTGCCGTGGTGGGAGGAATGACAACATATAA
AA sequence Show only first row Show all	>Potri.018G007500.1 pacid=42801838 polypeptide=Potri.018G007500.1.p locus=Potri.018G007500 ID=Potri.018G007500.1.v4.1 annot-version=v4.1 MSPSNKLMALGLCMLMACTLFAGNAEATRDINYGAIVKGDHEPFCGPTHPCVKTPANGYHRGCETINKCRGGRNDNI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61566		RALFL9	ralf-like 9 (.1)		Potri.018G007500 [exp]	0	1
AT2G32835		RALFL16	RALF-like 16 (.1)		Potri.018G007800 [exp]	4.00	0.6820
AT1G80040			unknown protein		Potri.005G121100 [exp]	12.84	0.7159
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Potri.012G017600 [exp]	30.98	0.6776	BIP.3
					Potri.011G143050 [exp]	80.69	0.6468
					Potri.016G141150 [exp]	137.14	0.6166
AT5G13200			GRAM domain family protein (.1...		Potri.003G165400 [exp]	157.68	0.6059
AT3G12410			Polynucleotidyl transferase, r...		Potri.002G185500 [exp]	162.44	0.6063
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Potri.014G107900 [exp]	164.37	0.5575
AT4G22140		EBS	EARLY BOLTING IN SHORT DAYS, P...		Potri.014G157100 [exp]	189.77	0.5558
AT4G38040			Exostosin family protein (.1)		Potri.007G117800 [exp]	235.90	0.5468

Compare expression of checked genes

Potri.018G007500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.