Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61566 50 / 7e-10 RALFL9 ralf-like 9 (.1) AT2G32835 49 / 2e-09 RALFL16 RALF-like 16 (.1) AT1G60815 47 / 1e-08 RALFL7 RALF-like 7 (.1) AT1G60625 44 / 3e-07 RALFL6 RALF-like 6 (.1) AT2G22055 42 / 2e-06 RALFL15 RALF-like 15 (.1) AT1G61563 39 / 2e-05 RALFL8 ralf-like 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G007800 [exp] 122 / 2e-38 AT2G32835 51 / 6e-10 RALF-like 16 (.1) Potri.018G007500 [exp] 101 / 3e-30 AT1G61566 58 / 6e-13 ralf-like 9 (.1) Potri.018G007701 [exp] 101 / 3e-30 AT1G61566 58 / 6e-13 ralf-like 9 (.1) Potri.019G102400 [exp] 39 / 2e-05 AT1G23145 50 / 2e-09 RALF-like 2 (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [poplar] [flax] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Potri.018G007600.1 pacid=42800567 polypeptide=Potri.018G007600.1.p locus=Potri.018G007600 ID=Potri.018G007600.1.v4.1 annot-version=v4.1 ATGTCTCCCTCAAACAAGTTGATGGCTTTGGGGCTTTGCATGCTGATGGCATGCACTCTTTTTGCAGGAAACGCAGAGGCGACTAGATCTATTAATTATG GAGCTATCGTTAAAGGTGATCACGAACCCTTCTGTGGCCCAAAACATCCATGTGTGAAGACACCTGCAAATAGGTACTCTAGAGGTTGCGAAACTTTTTA TAGGTGCCATGGTTGGTGGGATCGATGA
AA sequence Show only first row Show all	>Potri.018G007600.1 pacid=42800567 polypeptide=Potri.018G007600.1.p locus=Potri.018G007600 ID=Potri.018G007600.1.v4.1 annot-version=v4.1 MSPSNKLMALGLCMLMACTLFAGNAEATRSINYGAIVKGDHEPFCGPKHPCVKTPANRYSRGCETFYRCHGWWDR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G61566		RALFL9	ralf-like 9 (.1)		Potri.018G007600 [exp]	0	1
AT1G22220		AUF2	auxin up-regulated f-box prote...		Potri.001G021900 [exp]	5.09	0.6418
AT3G30387			Protein of unknown function (D...		Potri.017G039125 [exp]	8.48	0.6045
AT1G43730			RNA-directed DNA polymerase (r...		Potri.004G000150 [exp]	14.69	0.5638
AT5G26330			Cupredoxin superfamily protein...		Potri.006G259000 [exp]	15.42	0.5655
					Potri.008G182350 [exp]	19.07	0.4964
AT4G22080		RHS14	root hair specific 14 (.1)		Potri.004G007300 [exp]	21.00	0.5629
AT2G19320			unknown protein		Potri.006G073300 [exp]	21.42	0.5325
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Potri.006G005000 [exp]	22.13	0.5629
					Potri.001G190450 [exp]	23.87	0.5286
AT3G02100			UDP-Glycosyltransferase superf...		Potri.010G084900 [exp]	28.84	0.5347

Compare expression of checked genes

Potri.018G007600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.