Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23280 105 / 6e-26 XBAT35 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) AT4G14365 79 / 1e-16 XBAT34 XB3 ortholog 4 in Arabidopsis thaliana (.1) AT2G24640 70 / 1e-13 UBP19 ubiquitin-specific protease 19 (.1.2) AT2G38195 58 / 9e-10 RING/U-box superfamily protein (.1.2) AT4G31670 57 / 3e-09 UBP18 ubiquitin-specific protease 18 (.1) AT2G38220 56 / 4e-09 RING/U-box superfamily protein (.1) AT2G38185 51 / 3e-07 RING/U-box superfamily protein (.1.2.3.4) AT2G34920 51 / 3e-07 EDA18 embryo sac development arrest 18, RING/U-box superfamily protein (.1) AT5G65450 51 / 3e-07 UBP17 ubiquitin-specific protease 17 (.1) AT5G19080 50 / 5e-07 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G225300 [exp] 259 / 3e-84 AT3G23280 355 / 2e-118 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Potri.010G070750 [exp] 135 / 9e-37 AT3G23280 425 / 4e-146 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Potri.010G070800 [exp] 131 / 2e-35 AT3G23280 502 / 2e-176 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Potri.008G167600 [exp] 128 / 3e-34 AT3G23280 501 / 1e-175 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Potri.018G009500 [exp] 114 / 8e-29 AT2G24640 686 / 0.0 ubiquitin-specific protease 19 (.1.2) Potri.006G270600 [exp] 92 / 5e-21 AT2G24640 698 / 0.0 ubiquitin-specific protease 19 (.1.2) Potri.006G100400 [exp] 58 / 2e-09 AT2G38185 341 / 2e-113 RING/U-box superfamily protein (.1.2.3.4) Potri.001G251900 [exp] 56 / 6e-09 AT5G01450 327 / 7e-108 RING/U-box superfamily protein (.1) Potri.016G116300 [exp] 56 / 9e-09 AT5G01450 348 / 3e-116 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003551 [exp] 171 / 5e-53 AT3G23280 115 / 5e-30 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10009035 [exp] 123 / 2e-32 AT3G23280 524 / 0.0 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10009674 [exp] 110 / 1e-27 AT3G23280 499 / 6e-175 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10020116 [exp] 71 / 1e-13 AT2G24640 686 / 0.0 ubiquitin-specific protease 19 (.1.2) Lus10026918 [exp] 70 / 2e-13 AT2G24640 686 / 0.0 ubiquitin-specific protease 19 (.1.2) Lus10033896 [exp] 67 / 1e-12 AT3G23280 294 / 7e-96 XB3 ortholog 5 in Arabidopsis thaliana (.1.2) Lus10002487 [exp] 54 / 3e-08 AT5G01450 347 / 5e-115 RING/U-box superfamily protein (.1) Lus10004813 [exp] 54 / 5e-08 AT2G38185 309 / 2e-100 RING/U-box superfamily protein (.1.2.3.4) Lus10004419 [exp] 51 / 4e-07 AT3G06140 350 / 4e-119 RING/U-box superfamily protein (.1) Lus10017455 [exp] 51 / 5e-07 AT5G04460 858 / 0.0 RING/U-box superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0175 [poplar] [flax] TRASH PF01753 [poplar] [flax] zf-MYND MYND finger CL0229 [poplar] [flax] RING PF13920 [poplar] [flax] zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Potri.018G011300.3 pacid=42800375 polypeptide=Potri.018G011300.3.p locus=Potri.018G011300 ID=Potri.018G011300.3.v4.1 annot-version=v4.1 ATGGAAGCTGAAGAGGATTCTGTTCGTTGTGTTAATTGTGGCAATTCGGGGTCTAAAACGTGTTCTCGTTGCAAATCTGTGAGATATTGCTCACAGGGAT GCCAAACAAAACACTGGAAGGCAGGCCATAGGTTAAAATGCAAGGATTTCAGAGCAAGCTCATCACGAACAGCAAAATCAAACTCTAAGCCTATTATAAA GAAGCCTGGAGTAACTAATCCAAACTTCTGGGAAGATCCTGTGCGTGGTGATAGCTACAACGGATGGGGCGCAACTGTTGCATCCACGCATTCAGCTGCA AGCGGCAGTGGATGGATGGAGGAGGCACCAAGAGAAGACTACAACGGATGGGGTGTGCCTAATATGGGGCCAAGTGGCATGAGTCAAGGTCATGTACAAA CCCATGATGATATTCCCCATGTTTTTGAAACATGTAGTGGAAATAATCCATCAGCTCCGCCAATTCCTGATGGGGCATTCGATGAAGAGCTTATCCATCA TCCGTCAATTGATTTTAGTCCACTGGACTTGTCTGTTCCAGCTATAGAGCATGGAGCTTCTGTAACAAGTGATGTGAACGAAGGAGGTACTTCTTCATGT ATAATATGCTGGGAGGCTCCTGTTGAAGGTGCATGCATTCCTTGTGGTCACATGGCTGGTTGTATGGCTTGTTTGAGTGAGATCAAAGCTAAGAAAGGTG TTTGCCCAGTTTGCCGATCCAATATAAACCAAGTTGTAAGGCTTTATGCTGTCTGA
AA sequence Show only first row Show all	>Potri.018G011300.3 pacid=42800375 polypeptide=Potri.018G011300.3.p locus=Potri.018G011300 ID=Potri.018G011300.3.v4.1 annot-version=v4.1 MEAEEDSVRCVNCGNSGSKTCSRCKSVRYCSQGCQTKHWKAGHRLKCKDFRASSSRTAKSNSKPIIKKPGVTNPNFWEDPVRGDSYNGWGATVASTHSAA SGSGWMEEAPREDYNGWGVPNMGPSGMSQGHVQTHDDIPHVFETCSGNNPSAPPIPDGAFDEELIHHPSIDFSPLDLSVPAIEHGASVTSDVNEGGTSSC IICWEAPVEGACIPCGHMAGCMACLSEIKAKKGVCPVCRSNINQVVRLYAV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G23280		XBAT35	XB3 ortholog 5 in Arabidopsis ...		Potri.018G011300 [exp]	0	1
AT5G22540			Plant protein of unknown funct...		Potri.004G187100 [exp]	1.41	0.9243
AT5G01850			Protein kinase superfamily pro...		Potri.016G134900 [exp]	2.82	0.8713
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Potri.010G032301 [exp]	3.16	0.8886
AT5G10030	bZIP	OBF4, TGA4	OCS ELEMENT BINDING FACTOR 4, ...		Potri.007G079900 [exp]	4.58	0.8910	STGA1.2
AT2G38730			Cyclophilin-like peptidyl-prol...		Potri.003G194500 [exp]	7.07	0.8664
AT1G25370			Protein of unknown function (D...		Potri.008G122600 [exp]	7.54	0.8394
AT5G43960			Nuclear transport factor 2 (NT...		Potri.014G192900 [exp]	8.83	0.8765
AT5G61030		GR-RBP3	glycine-rich RNA-binding prote...		Potri.012G061600 [exp]	9.53	0.8718
AT3G15351			unknown protein		Potri.002G142000 [exp]	9.94	0.8667
					Potri.001G265000 [exp]	10.00	0.8349

Compare expression of checked genes

Potri.018G011300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.