Potri.018G013600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25760 79 / 2e-19 ATGDU2 glutamine dumper 2 (.1)
AT5G57685 79 / 7e-19 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
AT4G31730 76 / 1e-17 ATGDU1, GDU1 glutamine dumper 1 (.1)
AT5G24920 73 / 9e-17 ATGDU5 glutamine dumper 5 (.1)
AT2G24762 69 / 4e-15 ATGDU4 glutamine dumper 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G267900 167 / 4e-53 AT5G57685 83 / 2e-20 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.006G173901 90 / 6e-23 AT5G57685 89 / 8e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Potri.004G108800 45 / 2e-06 AT5G24920 57 / 2e-11 glutamine dumper 5 (.1)
Potri.017G107100 44 / 2e-06 AT5G24920 48 / 2e-08 glutamine dumper 5 (.1)
Potri.017G107400 44 / 5e-06 AT4G31730 76 / 1e-18 glutamine dumper 1 (.1)
Potri.017G107300 41 / 4e-05 AT4G25760 75 / 1e-18 glutamine dumper 2 (.1)
Potri.004G108440 40 / 0.0001 AT5G38770 46 / 1e-07 glutamine dumper 7 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026911 99 / 2e-26 AT4G31730 125 / 6e-37 glutamine dumper 1 (.1)
Lus10020107 91 / 3e-23 AT4G31730 122 / 1e-35 glutamine dumper 1 (.1)
Lus10008910 89 / 3e-22 AT5G57685 125 / 6e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10006986 88 / 5e-22 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10019985 72 / 4e-16 AT5G57685 123 / 3e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10019986 72 / 5e-16 AT5G57685 125 / 7e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10006987 71 / 2e-15 AT5G57685 125 / 2e-37 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10015513 70 / 3e-15 AT5G57685 124 / 2e-36 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
Lus10008909 40 / 0.0001 AT5G57685 87 / 2e-23 LESS SUSCEPTIBLE TO BSCTV 1, ARABIDOPSIS THALIANA GLUTAMINE DUMPER 3, glutamine dumper 3 (.1)
PFAM info
Representative CDS sequence
>Potri.018G013600.1 pacid=42802171 polypeptide=Potri.018G013600.1.p locus=Potri.018G013600 ID=Potri.018G013600.1.v4.1 annot-version=v4.1
ATGAGACACATTAGCCACCTTGACACCACCATCAGCACCACAAAGGCAGCAGCCACTTCACCATCACCACCAGCAGTAGTCCAACCTCGCTCACCGTGGC
ACTCACCAGTGCCATACCTCTTTGGAGGTTTAGCAGCTATGTTGGGGTTGATTGCTTTTGCTTTATTAATCTTGGCTTGCTCTTATTGGAGAATTTCTGG
TCGTTTAGACAGTGAAAATGAAGGTAATGATCTTGAAAGTGGAAATGAAAAGGAAGGAAAGCCAGAGAATAAGGTTTTTGAAGAGAAGTTTTTGGTTATT
ATGGCTGGAAATGAGAAGCCAACATTTTTAGCCACTCCTGTTTGCAGCAAAGCCTCTTCCTTTGTAGCCAAGATTGATAACCAAGAAGAAGCGAAGACGG
GGAGTACACCTACTGGTCATGATGACAAGGTGAAAAATCAAGAAATGATTGGTGACAGCCATGATCAAGCAGCAACAACTACAACTGAAGAAAATACAGA
GACGCAAGAGAACCAGCAAGCTCAAGAACAAAATTAA
AA sequence
>Potri.018G013600.1 pacid=42802171 polypeptide=Potri.018G013600.1.p locus=Potri.018G013600 ID=Potri.018G013600.1.v4.1 annot-version=v4.1
MRHISHLDTTISTTKAAATSPSPPAVVQPRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRISGRLDSENEGNDLESGNEKEGKPENKVFEEKFLVI
MAGNEKPTFLATPVCSKASSFVAKIDNQEEAKTGSTPTGHDDKVKNQEMIGDSHDQAATTTTEENTETQENQQAQEQN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25760 ATGDU2 glutamine dumper 2 (.1) Potri.018G013600 0 1
AT4G29230 NAC ANAC075, NST9 NAC domain containing protein ... Potri.006G152700 10.29 0.6935
AT1G01490 Heavy metal transport/detoxifi... Potri.014G089700 16.79 0.6769
Potri.012G020400 39.11 0.6137
AT2G26850 F-box family protein (.1) Potri.006G040000 41.10 0.6293
AT1G17950 MYB AtMYB52, BW52, ... myb domain protein 52 (.1) Potri.012G039400 46.28 0.6410 MYB.41
AT2G23460 ATXLG1, XLG1 extra-large G-protein 1 (.1) Potri.005G131200 67.52 0.5939 XLG.1
AT1G47330 CBS domain-containing protein ... Potri.014G196900 71.41 0.5610
AT1G57560 MYB ATMYB50 myb domain protein 50 (.1) Potri.010G004300 103.56 0.5840
AT4G13830 J20 DNAJ-like 20 (.1.2) Potri.001G319100 116.91 0.5309 Pt-DNAJ.2
AT1G29195 unknown protein Potri.004G057500 122.27 0.5216

Potri.018G013600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.