Potri.018G016500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80450 67 / 7e-14 VQ motif-containing protein (.1)
AT1G28280 56 / 8e-10 VQ motif-containing protein (.1.2)
AT5G53830 49 / 4e-07 VQ motif-containing protein (.1)
AT3G15300 48 / 5e-07 VQ motif-containing protein (.1)
AT2G33780 47 / 1e-06 VQ motif-containing protein (.1)
AT5G08480 44 / 2e-05 VQ motif-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G266700 191 / 2e-62 AT1G80450 79 / 1e-18 VQ motif-containing protein (.1)
Potri.006G266600 177 / 3e-57 AT1G80450 61 / 6e-12 VQ motif-containing protein (.1)
Potri.001G399100 67 / 1e-13 AT1G28280 190 / 2e-60 VQ motif-containing protein (.1.2)
Potri.011G118200 64 / 1e-12 AT1G28280 184 / 6e-58 VQ motif-containing protein (.1.2)
Potri.004G134200 51 / 4e-08 AT5G08480 150 / 1e-46 VQ motif-containing protein (.1.2)
Potri.004G044800 48 / 8e-07 AT1G28280 223 / 1e-72 VQ motif-containing protein (.1.2)
Potri.011G053700 47 / 2e-06 AT1G28280 213 / 6e-69 VQ motif-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026247 110 / 3e-30 AT1G80450 83 / 5e-20 VQ motif-containing protein (.1)
Lus10020092 109 / 4e-30 AT1G80450 86 / 5e-21 VQ motif-containing protein (.1)
Lus10042423 106 / 9e-29 AT1G80450 83 / 6e-20 VQ motif-containing protein (.1)
Lus10026897 76 / 5e-17 AT1G80450 67 / 4e-14 VQ motif-containing protein (.1)
Lus10015315 45 / 7e-06 AT1G28280 203 / 3e-65 VQ motif-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.018G016500.1 pacid=42800943 polypeptide=Potri.018G016500.1.p locus=Potri.018G016500 ID=Potri.018G016500.1.v4.1 annot-version=v4.1
ATGAAAATAGAAGGGTATAATCACATGAACACCATGGCAACTTCTTCTCCTCCAACATCACCTACAACCTTTGTTCAAGCAGACACAAACAGTTTTAGAG
ACCTTGTCCAGAAATTAACCGGTTTAGCTAGTGACACGCAACAACTTCCGGCAACAAGAATACTCTCCTCATCAAAATCATTTCACAGTCCCGTTGACTT
CACCGGCCCACGCCGGTCACCTTTCAAGCTCCAAGAACGTAGACATACCTCAAGAAAGCTAGAGATCAAACTTGGCCTGACCTCTCTCAGTAACTCTTCA
TCACCAGCCCGCCAAACACGCCAAGTCGAATCGCCAGTCACTCCACTTAGCTCAGAGTTTTTGTTTTTCCCGAGTCCAGGCACTACCGAGTCGCCATCTC
CACCAGCAGTTTTAGAGGAGGAGAAGGCCATAGCTGAAAAGGGTTTTTACTTGCATCCGTCGCCGTTGAATACACCAAGAGGGAGCGAGCCACCTGAGCT
GCTGCCTCTGTTTCCATTGAGTTCACCGAGTCAGAGCAATCAAGATTAG
AA sequence
>Potri.018G016500.1 pacid=42800943 polypeptide=Potri.018G016500.1.p locus=Potri.018G016500 ID=Potri.018G016500.1.v4.1 annot-version=v4.1
MKIEGYNHMNTMATSSPPTSPTTFVQADTNSFRDLVQKLTGLASDTQQLPATRILSSSKSFHSPVDFTGPRRSPFKLQERRHTSRKLEIKLGLTSLSNSS
SPARQTRQVESPVTPLSSEFLFFPSPGTTESPSPPAVLEEEKAIAEKGFYLHPSPLNTPRGSEPPELLPLFPLSSPSQSNQD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G80450 VQ motif-containing protein (.... Potri.018G016500 0 1
AT5G54390 ATAHL, AHL HAL2-like (.1) Potri.004G036400 7.14 0.7867
AT2G01190 PDE331 PIGMENT DEFECTIVE 331, Octicos... Potri.010G119500 7.54 0.8365
Potri.006G104150 22.73 0.7510
AT1G49310 unknown protein Potri.009G114400 23.06 0.7421
Potri.006G023450 23.06 0.7304
AT3G46130 MYB PFG3, ATMYB111 ... myb domain protein 48 (.1.2.3.... Potri.001G235500 26.60 0.7824 Pt-MYB111.2,MYB206
Potri.015G111101 28.39 0.7429
AT2G01190 PDE331 PIGMENT DEFECTIVE 331, Octicos... Potri.008G124700 29.89 0.7664
Potri.016G130101 32.55 0.7279
Potri.004G212900 36.66 0.7438

Potri.018G016500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.