Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25080 209 / 7e-69 ATGPX1 glutathione peroxidase 1 (.1) AT4G31870 208 / 1e-68 ATGPX7 glutathione peroxidase 7 (.1) AT4G11600 171 / 5e-54 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1) AT2G31570 156 / 6e-49 ATGPX2 glutathione peroxidase 2 (.1) AT2G43350 155 / 3e-48 ATGPX3 glutathione peroxidase 3 (.1.2) AT3G63080 150 / 2e-46 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1) AT2G48150 148 / 7e-46 ATGPX4 glutathione peroxidase 4 (.1) AT1G63460 146 / 4e-45 ATGPX8 glutathione peroxidase 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G265400 [exp] 218 / 1e-72 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1) Potri.001G105200 [exp] 171 / 7e-55 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1) Potri.003G126100 [exp] 169 / 3e-53 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1) Potri.007G126600 [exp] 166 / 2e-52 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1) Potri.014G138800 [exp] 154 / 4e-48 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1) Potri.001G105100 [exp] 151 / 1e-46 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026887 [exp] 216 / 2e-71 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1) Lus10003421 [exp] 215 / 5e-70 AT4G31870 319 / 9e-110 glutathione peroxidase 7 (.1) Lus10042418 [exp] 204 / 7e-67 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1) Lus10008022 [exp] 165 / 2e-52 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1) Lus10008537 [exp] 164 / 5e-52 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1) Lus10008499 [exp] 165 / 2e-51 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1) Lus10027021 [exp] 159 / 4e-50 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1) Lus10029651 [exp] 149 / 4e-46 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1) Lus10000603 [exp] 146 / 3e-45 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1) Lus10000601 [exp] 145 / 1e-44 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00255 [poplar] [flax] GSHPx Glutathione peroxidase
Representative CDS sequence Show only first row Show all	>Potri.018G017500.2 pacid=42801478 polypeptide=Potri.018G017500.2.p locus=Potri.018G017500 ID=Potri.018G017500.2.v4.1 annot-version=v4.1 ATGAGACAAATTTATTTTATGTTATGTTTCTTCAATCACACACGTTCTATTGGTTTTGCATCAACAAATTACTCAGAACTCACACACCTATATGAGAAGT ACAAGACTGAAGGATTTGAAATTCTGGCTTTTCCTTGCAATCAGTTTGGTGGGCAAGAACCTGGATCGAACCCTGAAATTAAACAGTTTGCTTGTGCCAG GTACAAAGCTGAATTTCCAATATTCGATAAGGTTGGTGTGAATGGACCAAGTACAGCTCCAGTTTATCAGTTTCTGAAATCAAGTGCTGGAGGATTTTTA GGTGGCCTGATCAAGTGGAACTTGGAGAAGTTCTTGGTGGACAAAAACAGCAAGGTTGTGGAGCGATATCCACTGCCAACATCACCTTTTCAAATCAAAA GGACATTCAGAAGCTCATCGTGGAATGCATGTTTGTCATCAGTGTTAAAGGAAGAAAAACAAATCAATACATGTAAATTTGTGCTCCAGTCATCACAGTT TATCCACAAGTGTTTTCTGCAATAG
AA sequence Show only first row Show all	>Potri.018G017500.2 pacid=42801478 polypeptide=Potri.018G017500.2.p locus=Potri.018G017500 ID=Potri.018G017500.2.v4.1 annot-version=v4.1 MRQIYFMLCFFNHTRSIGFASTNYSELTHLYEKYKTEGFEILAFPCNQFGGQEPGSNPEIKQFACARYKAEFPIFDKVGVNGPSTAPVYQFLKSSAGGFL GGLIKWNLEKFLVDKNSKVVERYPLPTSPFQIKRTFRSSSWNACLSSVLKEEKQINTCKFVLQSSQFIHKCFLQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G25080		ATGPX1	glutathione peroxidase 1 (.1)		Potri.018G017500 [exp]	0	1
AT1G67090		RBCS1A	ribulose bisphosphate carboxyl...		Potri.004G100000 [exp]	2.44	0.9595
AT2G24270		ALDH11A3	aldehyde dehydrogenase 11A3 (....		Potri.018G109700 [exp]	8.00	0.9521	Pt-ALDH11.1
AT2G20340			Pyridoxal phosphate (PLP)-depe...		Potri.004G036200 [exp]	8.48	0.9151
AT2G39730		RCA	rubisco activase (.1.2.3)		Potri.010G200500 [exp]	8.83	0.9410
AT3G26060		ATPRXQ ,ATPRX Q	peroxiredoxin Q, Thioredoxin s...		Potri.006G137500 [exp]	9.48	0.9456	Pt-PRXQ.1
					Potri.001G188400 [exp]	16.12	0.9386
AT3G63410		VTE3, APG1, IEP...	VITAMIN E DEFECTIVE 3, INNER E...		Potri.008G159400 [exp]	16.73	0.9413	Pt-APG1.1
AT5G05580		AtFAD8, SH1, FA...	fatty acid desaturase 8 (.1.2)		Potri.008G069600 [exp]	16.91	0.9217	FAD3.4
AT2G21280		GC1, ATSULA	GIANT CHLOROPLAST 1, NAD(P)-bi...		Potri.009G124800 [exp]	18.52	0.9404	GC1.1
AT5G38660		APE1	acclimation of photosynthesis ...		Potri.017G112700 [exp]	21.63	0.9388

Compare expression of checked genes

Potri.018G017500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.