Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25170 301 / 8e-105 PPPDE putative thiol peptidase family protein (.1) AT2G25190 270 / 4e-92 PPPDE putative thiol peptidase family protein (.1) AT1G80690 254 / 5e-86 PPPDE putative thiol peptidase family protein (.1) AT4G31980 254 / 1e-80 unknown protein AT1G47740 234 / 3e-77 PPPDE putative thiol peptidase family protein (.1.2) AT4G17486 206 / 3e-67 PPPDE putative thiol peptidase family protein (.1.2) AT5G47310 207 / 5e-67 PPPDE putative thiol peptidase family protein (.1) AT4G25660 95 / 2e-23 PPPDE putative thiol peptidase family protein (.1) AT4G25680 94 / 4e-23 PPPDE putative thiol peptidase family protein (.1) AT3G07090 62 / 2e-11 PPPDE putative thiol peptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G261500 [exp] 376 / 8e-134 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1) Potri.003G180400 [exp] 272 / 4e-93 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1) Potri.001G047800 [exp] 263 / 1e-89 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1) Potri.004G151200 [exp] 238 / 2e-79 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2) Potri.002G134200 [exp] 237 / 9e-79 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2) Potri.014G042300 [exp] 234 / 8e-78 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2) Potri.T126004 [exp] 234 / 8e-78 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.009G113168 [exp] 233 / 2e-77 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2) Potri.003G080300 [exp] 215 / 2e-70 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041021 [exp] 315 / 5e-110 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1) Lus10017127 [exp] 313 / 1e-109 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1) Lus10018326 [exp] 313 / 2e-109 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1) Lus10005341 [exp] 308 / 2e-107 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1) Lus10042454 [exp] 245 / 8e-82 AT1G80690 265 / 1e-89 PPPDE putative thiol peptidase family protein (.1) Lus10026215 [exp] 243 / 6e-81 AT1G80690 265 / 8e-90 PPPDE putative thiol peptidase family protein (.1) Lus10032708 [exp] 231 / 1e-76 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2) Lus10040485 [exp] 228 / 3e-75 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2) Lus10003951 [exp] 228 / 3e-75 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2) Lus10011291 [exp] 227 / 7e-75 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF05903 [poplar] [flax] Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence Show only first row Show all	>Potri.018G021700.1 pacid=42800688 polypeptide=Potri.018G021700.1.p locus=Potri.018G021700 ID=Potri.018G021700.1.v4.1 annot-version=v4.1 ATGCTGCGTAGAATGGTGATGTTGAACCAGAAAAAGAAAACTGGGACGGTTCCAGTTTACTTAAATGTTTATGATTTGACGACGATTAATGGTTACGCTT ACTGGGTTGGTCTCGGGATCTACCATTCCGGTGTACAAGTTCACGGTGTTGAATATGGTTTTGGAGCACATGATCATCCGACAACGGGGATTTTTGAGGT TGAGCCGAAGCAATGCCCGGGATTTATGTTTAGGAAATCAATATTGATTGGAAGAACTGATTTGGGTCCTAAAGAAGTTCGGGTGTTCATGGAGAAATTA GCTCAGGAGTTTCCTGGGAATACTTACCATCTTATCACTAAGAACTGCAATCACTTCTGTAATGATGTGTGTCTCAAGTTGACTGGGAAAAAAATTCCAC GATGGGTTAATCGTCTTGCTCGTATAGGTTTTCTTTGCAACTGTGTTCTTCCAGTGGAGTTGAATCAAACAAAAATCCGCCAAGTTAGATCCGATGATAT TGTACAAGAGAAGAAGAAATTGAGAAGCCGTTCGACTAGGTTCCCATCTTCTTCTAATCCGGTAACTTCCCCTTCATTGACACCTTGCCCTTCAAGTTCT GGAAGCAGAAGTGGTAGACAGAGACGTTTTATTCCTCTGACTTCAAGATCTTTTGTTCATGATGACTCTACGTCCTCGTCATGGAGCTTGAAGGCTTAA
AA sequence Show only first row Show all	>Potri.018G021700.1 pacid=42800688 polypeptide=Potri.018G021700.1.p locus=Potri.018G021700 ID=Potri.018G021700.1.v4.1 annot-version=v4.1 MLRRMVMLNQKKKTGTVPVYLNVYDLTTINGYAYWVGLGIYHSGVQVHGVEYGFGAHDHPTTGIFEVEPKQCPGFMFRKSILIGRTDLGPKEVRVFMEKL AQEFPGNTYHLITKNCNHFCNDVCLKLTGKKIPRWVNRLARIGFLCNCVLPVELNQTKIRQVRSDDIVQEKKKLRSRSTRFPSSSNPVTSPSLTPCPSSS GSRSGRQRRFIPLTSRSFVHDDSTSSSWSLKA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G25170			PPPDE putative thiol peptidase...		Potri.018G021700 [exp]	0	1
AT1G13250		GATL3	galacturonosyltransferase-like...		Potri.008G116900 [exp]	1.73	0.8704
AT5G55650			unknown protein		Potri.001G367100 [exp]	5.29	0.8470
AT2G37195			unknown protein		Potri.016G090000 [exp]	6.48	0.8552
AT4G10810			unknown protein		Potri.014G013600 [exp]	8.48	0.8542
AT3G58170		ATBET11, ATBS14...	ARABIDOPSIS THALIANA BET1P/SFT...		Potri.002G041500 [exp]	11.61	0.8433	Pt-BET11.2
AT5G48460			Actin binding Calponin homolog...		Potri.002G251600 [exp]	13.41	0.8203
AT5G25170			PPPDE putative thiol peptidase...		Potri.006G261500 [exp]	13.96	0.7880
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Potri.002G129800 [exp]	18.97	0.7853
AT5G06610			Protein of unknown function (D...		Potri.006G196800 [exp]	20.04	0.8359
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Potri.016G098200 [exp]	20.63	0.7853	Pt-TIP2.8

Compare expression of checked genes

Potri.018G021700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.