Plant FIBer expression Database

Potri.018G024000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G257700
[exp]
120 / 6e-35 ND /
Potri.006G257800
[exp]
112 / 2e-31 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.018G024000.2 pacid=42801872 polypeptide=Potri.018G024000.2.p locus=Potri.018G024000 ID=Potri.018G024000.2.v4.1 annot-version=v4.1
ATGGAGGGTCTTGTTTGCTCAAACGCTGTCGTTTTGGAGGGCTTCCTCTCTTCTCTCATTGAAGCCGTGGTACTTGAAACAGCCATTGCTGCTTGGAAGG
CACTTGCTTTGTCACTTTTCATGATAGGTTCTTTGCCTAACAGATCCAGTGACATCCCAGAAGAGTCAGGCACAAGTCGAGGGTTTCCATTTACTGGGCT
TCACGTAAGGAAGAAACCTGATCCTGATAATCAAGATGCCAGTGATACCGAGGATGATGAAGACGATGAGGATGGCCAAGATGATCAGGACGAGGATGAT
GAAGGCGATGATGAGGATGTGCCTGACAAAGGAGAGGATGGTGAGGATCTGGAGGATGAGCCTGAAGCCAATGGTGATGGTGGCAGTGATGATGATGATG
ATGAAGAAGACGATGATGATGAGGAAGATGAAGACGACGATGATGACGAGGAGGATGAAGACGAGGATGAAGAGGAGGATGAGGAAGATATTCCCCAGCC
ACCATCTAAGAAGAGGAAATGA
AA sequence
>Potri.018G024000.2 pacid=42801872 polypeptide=Potri.018G024000.2.p locus=Potri.018G024000 ID=Potri.018G024000.2.v4.1 annot-version=v4.1
MEGLVCSNAVVLEGFLSSLIEAVVLETAIAAWKALALSLFMIGSLPNRSSDIPEESGTSRGFPFTGLHVRKKPDPDNQDASDTEDDEDDEDGQDDQDEDD
EGDDEDVPDKGEDGEDLEDEPEANGDGGSDDDDDEEDDDDEEDEDDDDDEEDEDEDEEEDEEDIPQPPSKKRK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.018G024000
[exp]
0 1
AT5G46160 Ribosomal protein L14p/L23e fa... Potri.010G022800
[exp]
6.24 0.7264 RPL14.1
AT5G30495 Fcf2 pre-rRNA processing prote... Potri.008G206400
[exp]
24.49 0.7188
AT1G08220 unknown protein Potri.009G002000
[exp]
25.49 0.6954
AT2G01640 unknown protein Potri.009G097000
[exp]
32.40 0.6857
Potri.006G257800
[exp]
35.49 0.7123
AT2G18850 SET domain-containing protein ... Potri.006G168900
[exp]
36.66 0.6293
AT1G26340 B5 #6, B5#6, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Potri.010G156900
[exp]
58.01 0.6587 B5.2
AT5G44170 S-adenosyl-L-methionine-depend... Potri.017G017000
[exp]
59.49 0.6239
AT2G02880 mucin-related (.1) Potri.015G004400
[exp]
66.27 0.6751
AT5G15750 Alpha-L RNA-binding motif/Ribo... Potri.004G113600
[exp]
70.46 0.6662

Potri.018G024000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.