Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45180 127 / 6e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G62510 108 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46890 107 / 5e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12510 105 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 105 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46900 104 / 8e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G12090 102 / 3e-29 ELP extensin-like protein (.1) AT4G00165 102 / 6e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G12490 103 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 102 / 1e-28 AZI1 azelaic acid induced 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G256100 [exp] 137 / 5e-43 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 112 / 9e-33 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 110 / 5e-32 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 109 / 8e-32 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 104 / 5e-30 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G121800 [exp] 102 / 4e-29 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 99 / 2e-27 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.013G128800 [exp] 97 / 6e-27 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008300 [exp] 99 / 1e-26 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032253 [exp] 121 / 3e-36 ND 139 / 2e-43 Lus10032254 [exp] 120 / 3e-36 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024616 [exp] 120 / 3e-36 AT4G12520 139 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024615 [exp] 121 / 6e-36 ND 139 / 6e-43 Lus10001493 [exp] 117 / 6e-35 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002927 [exp] 110 / 2e-32 AT1G62510 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 105 / 5e-30 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032261 [exp] 105 / 6e-30 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10004348 [exp] 104 / 9e-30 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032263 [exp] 103 / 1e-29 AT4G12520 135 / 9e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF00234 [poplar] [flax] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Potri.018G025900.1 pacid=42801525 polypeptide=Potri.018G025900.1.p locus=Potri.018G025900 ID=Potri.018G025900.1.v4.1 annot-version=v4.1 ATGGCTTCCGAGAAACTCACTGCCACCATTTTGATCCTATCCCTCCTTTTCTTCTCAACATTCTCCAGTGCTTGCGGTCCTTGCCAACCTAAGACTCCCC CAACAGAACCAACTTGTCCCAGAGACACATTGAAGTTAGGAGCCTGTGCTGACATCCTTGGACTTGTTAATGTTGTTGTTGGAAGCCCACCTTATAGCAA GTGCTGTCCTCTGCTTGAAGGCTTGGCTGACTTGGAAGTTGCCTTGTGTCTTTGCACTGCTATTAAAGCTAGTGTGCTTGGAATTAACTTGAATGTGCCG GTTGCTCTAAGCGTACTTGTCAGTGCATGTGGCAAATCTATCCCTCCTGGCTTCAAATGTGAATGA
AA sequence Show only first row Show all	>Potri.018G025900.1 pacid=42801525 polypeptide=Potri.018G025900.1.p locus=Potri.018G025900 ID=Potri.018G025900.1.v4.1 annot-version=v4.1 MASEKLTATILILSLLFFSTFSSACGPCQPKTPPTEPTCPRDTLKLGACADILGLVNVVVGSPPYSKCCPLLEGLADLEVALCLCTAIKASVLGINLNVP VALSVLVSACGKSIPPGFKCE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45180			Bifunctional inhibitor/lipid-t...		Potri.018G025900 [exp]	0	1
AT1G02260			Divalent ion symporter (.1)		Potri.012G144000 [exp]	1.41	0.9992
AT1G68530		KCS6, CER6, POP...	POLLEN-PISTIL INCOMPATIBILITY ...		Potri.010G125300 [exp]	2.82	0.9992	CUT1.1
AT3G44540		FAR4	fatty acid reductase 4 (.1.2)		Potri.019G075201 [exp]	3.46	0.9991
AT2G10940			Bifunctional inhibitor/lipid-t...		Potri.018G126000 [exp]	3.74	0.9981
AT1G68530		KCS6, CER6, POP...	POLLEN-PISTIL INCOMPATIBILITY ...		Potri.008G120300 [exp]	4.47	0.9989
AT1G29660			GDSL-like Lipase/Acylhydrolase...		Potri.018G089500 [exp]	5.65	0.9970
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Potri.004G096066 [exp]	6.48	0.9912
AT4G33790		G7, FAR3, CER4	FATTY ACID REDUCTASE 3, ECERIF...		Potri.009G144900 [exp]	6.92	0.9980
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Potri.001G056200 [exp]	7.74	0.9956
AT4G23400		PIP1D, PIP1;5	plasma membrane intrinsic prot...		Potri.009G128500 [exp]	8.06	0.9983

Compare expression of checked genes

Potri.018G025900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.