Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11190 205 / 5e-68 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 200 / 5e-66 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT1G15360 191 / 2e-62 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25190 88 / 5e-22 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT4G28140 72 / 2e-15 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G53290 71 / 9e-15 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT2G22200 70 / 2e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G11140 69 / 3e-14 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT2G47520 67 / 3e-14 AP2_ERF AtERF71, ERF71, HRE2 HYPOXIA RESPONSIVE ERF \(ETHYLENE RESPONSE FACTOR\) 2, Arabidopsis thaliana ethylene response factor 71, Integrase-type DNA-binding superfamily protein (.1) AT1G46768 67 / 4e-14 AP2_ERF RAP2.1 related to AP2 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G253800 [exp] 292 / 4e-102 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 205 / 8e-68 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 187 / 8e-61 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 182 / 4e-59 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 87 / 2e-21 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 87 / 2e-21 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 85 / 7e-21 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.013G158500 [exp] 72 / 2e-15 AT4G27950 124 / 1e-32 cytokinin response factor 4 (.1) Potri.019G131300 [exp] 71 / 1e-14 AT4G27950 139 / 2e-38 cytokinin response factor 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030097 [exp] 213 / 1e-70 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 211 / 5e-70 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 192 / 5e-63 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 176 / 2e-56 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 174 / 5e-55 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002912 [exp] 161 / 1e-50 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2) Lus10043271 [exp] 137 / 1e-40 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10003506 [exp] 115 / 2e-33 AT1G15360 105 / 3e-29 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10041023 [exp] 98 / 8e-26 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 85 / 3e-21 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G028000.1 pacid=42801452 polypeptide=Potri.018G028000.1.p locus=Potri.018G028000 ID=Potri.018G028000.1.v4.1 annot-version=v4.1 ATGGTACAATCAAAGAAATTCAGAGGCGTCAGGCAACGCCAGTGGGGCTCTTGGGTGTCTGAAATTCGCCACCCATTACTGAAGAGGAGGGTGTGGCTGG GGACATTTGAGACAGCTGAGGCAGCAGCAAGAGCGTATGATCAAGCAGCTATATTGATGAATGGACAGAATGCCAAGACCAATTTCCCGACAAGTCACCT TGATCAAGACACAAATCTTGGCAAAGATAACAACTCTCCCTTGCCTGCCAAGGCACTGGCTGAGCTTCTCAACTCAAAGCTAAGAAAGTGTTGCGGCAAA GACCCTTCTCCTTCACTCACTTGCCTGAGGCTTGATAATGATAACTCTCATATTGGTGTGTGGCAGAAGAAAGCTGGTTCTCGTTCAAGTTCAAATTGGG TCATGAAGGTGGAGCTTGGAAATTACAACAAGAAGACAGAGTCATCGCCGACGGTTGAGATTGAGCCGGAAAATGGTACGGAAGAAGAGGATAGAATTGC TATGCAAATGATAGAAGAGCTGCTCAATCGGAATTGA
AA sequence Show only first row Show all	>Potri.018G028000.1 pacid=42801452 polypeptide=Potri.018G028000.1.p locus=Potri.018G028000 ID=Potri.018G028000.1.v4.1 annot-version=v4.1 MVQSKKFRGVRQRQWGSWVSEIRHPLLKRRVWLGTFETAEAAARAYDQAAILMNGQNAKTNFPTSHLDQDTNLGKDNNSPLPAKALAELLNSKLRKCCGK DPSPSLTCLRLDNDNSHIGVWQKKAGSRSSSNWVMKVELGNYNKKTESSPTVEIEPENGTEEEDRIAMQMIEELLNRN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G11190	AP2_ERF	SHN2, SHN3	shine2, Integrase-type DNA-bin...		Potri.018G028000 [exp]	0	1
AT1G32190			alpha/beta-Hydrolases superfam...		Potri.003G096900 [exp]	5.74	0.8428
AT5G01020			Protein kinase superfamily pro...		Potri.016G143200 [exp]	5.74	0.7942
					Potri.001G006250 [exp]	9.16	0.8081
AT4G19180			GDA1/CD39 nucleoside phosphata...		Potri.015G079900 [exp]	14.73	0.7548
AT4G14340		CKL11, CKI1	CASEIN KINASE I-LIKE 11, casei...		Potri.013G047200 [exp]	17.88	0.7121	Pt-CKI1.1
AT3G19940			Major facilitator superfamily ...		Potri.007G073800 [exp]	18.97	0.8120
AT3G19940			Major facilitator superfamily ...		Potri.007G073850 [exp]	23.21	0.8060
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Potri.015G118101 [exp]	23.74	0.7931
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Potri.006G078101 [exp]	26.83	0.8099
AT1G03905		ABCI19	ATP-binding cassette I19, P-lo...		Potri.005G226600 [exp]	30.39	0.6671	Pt-POP.1

Compare expression of checked genes

Potri.018G028000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.