Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68620 100 / 2e-25 alpha/beta-Hydrolases superfamily protein (.1) AT5G16080 95 / 2e-23 ATCXE17 carboxyesterase 17 (.1) AT1G47480 76 / 8e-17 alpha/beta-Hydrolases superfamily protein (.1) AT3G48700 76 / 2e-16 ATCXE13 carboxyesterase 13 (.1) AT5G62180 72 / 2e-15 ATCXE20 carboxyesterase 20 (.1) AT3G48690 71 / 8e-15 ATCXE12 ARABIDOPSIS THALIANA CARBOXYESTERASE 12, alpha/beta-Hydrolases superfamily protein (.1) AT1G49640 71 / 9e-15 alpha/beta-Hydrolases superfamily protein (.1) AT1G19190 66 / 4e-13 alpha/beta-Hydrolases superfamily protein (.1) AT1G49650 66 / 5e-13 alpha/beta-Hydrolases superfamily protein (.1) AT5G23530 66 / 6e-13 ATCXE18 carboxyesterase 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G028300 [exp] 230 / 3e-76 AT1G68620 199 / 1e-61 alpha/beta-Hydrolases superfamily protein (.1) Potri.006G253300 [exp] 208 / 6e-68 AT5G16080 173 / 9e-52 carboxyesterase 17 (.1) Potri.016G031500 [exp] 102 / 4e-26 AT1G68620 159 / 5e-46 alpha/beta-Hydrolases superfamily protein (.1) Potri.009G105000 [exp] 100 / 1e-25 AT2G03550 234 / 1e-75 alpha/beta-Hydrolases superfamily protein (.1) Potri.004G101400 [exp] 96 / 6e-24 AT5G16080 357 / 6e-123 carboxyesterase 17 (.1) Potri.001G032400 [exp] 93 / 9e-23 AT1G68620 185 / 9e-56 alpha/beta-Hydrolases superfamily protein (.1) Potri.010G127600 [exp] 92 / 2e-22 AT5G16080 346 / 2e-118 carboxyesterase 17 (.1) Potri.003G192650 [exp] 91 / 4e-22 AT5G16080 182 / 1e-54 carboxyesterase 17 (.1) Potri.017G113700 [exp] 89 / 3e-21 AT5G16080 358 / 3e-123 carboxyesterase 17 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002019 [exp] 186 / 7e-59 AT5G16080 218 / 1e-68 carboxyesterase 17 (.1) Lus10002907 [exp] 177 / 2e-55 AT5G16080 204 / 3e-63 carboxyesterase 17 (.1) Lus10019885 [exp] 103 / 4e-27 AT2G03550 173 / 1e-52 alpha/beta-Hydrolases superfamily protein (.1) Lus10014033 [exp] 94 / 5e-23 AT1G47480 246 / 3e-79 alpha/beta-Hydrolases superfamily protein (.1) Lus10017587 [exp] 91 / 4e-22 AT5G16080 329 / 5e-112 carboxyesterase 17 (.1) Lus10041473 [exp] 90 / 2e-21 AT1G68620 248 / 5e-80 alpha/beta-Hydrolases superfamily protein (.1) Lus10033548 [exp] 89 / 2e-21 AT5G16080 330 / 3e-112 carboxyesterase 17 (.1) Lus10021743 [exp] 86 / 3e-20 AT3G48700 291 / 2e-97 carboxyesterase 13 (.1) Lus10012073 [exp] 84 / 2e-19 AT3G48700 315 / 6e-107 carboxyesterase 13 (.1) Lus10008439 [exp] 83 / 4e-19 AT5G06570 281 / 8e-94 alpha/beta-Hydrolases superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [poplar] [flax] AB_hydrolase PF07859 [poplar] [flax] Abhydrolase_3 alpha/beta hydrolase fold
Representative CDS sequence Show only first row Show all	>Potri.018G028400.2 pacid=42800942 polypeptide=Potri.018G028400.2.p locus=Potri.018G028400 ID=Potri.018G028400.2.v4.1 annot-version=v4.1 ATGTCTATAGTTGCAGAGATACCTGGCTTCCTGCAAGTCTTTTCTGATGGGTTGGTAAAACGGTTTGCCCCAGGAATAGTGCCTGCCTCATCCAAATCAT ATTCCAACGGATTCAAGTTCAAAGATGTGACCATTGACTCATCTAAGAAAATAACTGCAAGATTGTCCCTTCCTGATACTCCTGCTTCCATGATTCAGCT TCCAGTTGTGGTTCATTTTCATGGAGGTTGCTTTTGCTTTTGCTCAACCACATGGCTTGGGTTCAATCACTTCCCTGGAGATTTATCTGTGGCGTCTCAG TCCATTGTCCTCTCTGTTGACTATCGTTTGGCACCGGAGAATCGCCTTCCGATTGGCTATGATGACTGTTTCAGCTCACTTGAACGACTGTGTAACAATG CGAGCTCTGACCCTTGGCTTATTAAGCAGGCTGATCTTTCTCCGATTATTTCTTTCTGGAGATGGTGCTGGATGAAACATAACACGCCAGGTTGCAATCA AAACAATGAGGAGAGGAGATTGTCATATTAA
AA sequence Show only first row Show all	>Potri.018G028400.2 pacid=42800942 polypeptide=Potri.018G028400.2.p locus=Potri.018G028400 ID=Potri.018G028400.2.v4.1 annot-version=v4.1 MSIVAEIPGFLQVFSDGLVKRFAPGIVPASSKSYSNGFKFKDVTIDSSKKITARLSLPDTPASMIQLPVVVHFHGGCFCFCSTTWLGFNHFPGDLSVASQ SIVLSVDYRLAPENRLPIGYDDCFSSLERLCNNASSDPWLIKQADLSPIISFWRWCWMKHNTPGCNQNNEERRLSY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68620			alpha/beta-Hydrolases superfam...		Potri.018G028400 [exp]	0	1
					Potri.016G121650 [exp]	14.42	0.8581
AT3G47570			Leucine-rich repeat protein ki...		Potri.015G037400 [exp]	16.97	0.8374
AT1G19800		ABCI14, TGD1	ATP-binding cassette I14, trig...		Potri.002G234400 [exp]	21.72	0.8482
					Potri.017G095500 [exp]	27.34	0.8320
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G222100 [exp]	27.65	0.8330
AT5G45040		CYTC6A	cytochrome c6A, Cytochrome c (...		Potri.015G121101 [exp]	34.85	0.8257
AT1G73530			RNA-binding (RRM/RBD/RNP motif...		Potri.012G038200 [exp]	35.21	0.8470
AT4G14210		PDE226, PDS3	PIGMENT DEFECTIVE 226, phytoen...		Potri.004G177400 [exp]	37.94	0.8221
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G221700 [exp]	47.95	0.8199
AT5G08280		HEMC	hydroxymethylbilane synthase (...		Potri.005G091600 [exp]	62.04	0.8265

Compare expression of checked genes

Potri.018G028400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.