Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18660 94 / 1e-25 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1) AT4G30380 62 / 4e-13 EXLB2 Barwin-related endoglucanase (.1) AT2G45110 38 / 0.0007 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G252200 [exp] 242 / 3e-84 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1) Potri.018G031901 [exp] 108 / 4e-31 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1) Potri.006G155000 [exp] 106 / 3e-30 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1) Potri.006G249500 [exp] 105 / 3e-30 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1) Potri.006G179300 [exp] 101 / 1e-28 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1) Potri.018G101600 [exp] 100 / 4e-28 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1) Potri.018G098200 [exp] 96 / 1e-26 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1) Potri.003G218300 [exp] 84 / 1e-21 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1) Potri.006G176300 [exp] 81 / 1e-20 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030078 [exp] 159 / 4e-51 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1) Lus10033054 [exp] 101 / 3e-28 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1) Lus10019444 [exp] 100 / 3e-28 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1) Lus10013118 [exp] 100 / 5e-28 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1) Lus10042435 [exp] 85 / 1e-21 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1) Lus10019978 [exp] 71 / 2e-16 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1) Lus10026232 [exp] 66 / 2e-14 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1) Lus10031759 [exp] 65 / 4e-14 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1) Lus10020131 [exp] 55 / 4e-10 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1) Lus10017763 [exp] 52 / 7e-10 ND 35 / 0.001
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [poplar] [flax] DPBB PF03330 [poplar] [flax] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Potri.018G029100.1 pacid=42801720 polypeptide=Potri.018G029100.1.p locus=Potri.018G029100 ID=Potri.018G029100.1.v4.1 annot-version=v4.1 ATGGCACTTATGGCCATAGCAATTGTAGCCATGAGCTTTCTCAGCTATGAAGTAGGCATTGTTCTTGGGGACATTGGCACTGCTACTTCGTATAATCCTC CCTATCTACCTACCAAGTGTCATGGCAATCGACAGGATCAATTCCCACCAGGAAACTTGTTTGTTTCTGTGAGTGAAGGTTTGTGGGATAATGGCGCTGC CTGTGGAAGGCGTTACAGGTTGAGGTGCCTAAGTGGAAATAATAGACCATGCAAGGATCAGACTATTGATGTTAGGGTGGTGGATTTCTGCAGAAAATCA CCATGCCCTTCTACTATTCTCTTGTCAGGTGACGCCTTTTCTGCTGTATCACACTCTCCATCCGCAAAAATCAATGTTGAATACATCCAGATATGA
AA sequence Show only first row Show all	>Potri.018G029100.1 pacid=42801720 polypeptide=Potri.018G029100.1.p locus=Potri.018G029100 ID=Potri.018G029100.1.v4.1 annot-version=v4.1 MALMAIAIVAMSFLSYEVGIVLGDIGTATSYNPPYLPTKCHGNRQDQFPPGNLFVSVSEGLWDNGAACGRRYRLRCLSGNNRPCKDQTIDVRVVDFCRKS PCPSTILLSGDAFSAVSHSPSAKINVEYIQI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Potri.018G029100 [exp]	0	1
AT4G22790			MATE efflux family protein (.1...		Potri.003G116700 [exp]	1.41	0.8632
AT1G19640		JMT	jasmonic acid carboxyl methylt...		Potri.014G168232 [exp]	3.00	0.8462
AT2G46780			RNA-binding (RRM/RBD/RNP motif...		Potri.012G022100 [exp]	8.06	0.8372
AT4G20260		ATPCAP1	ARABIDOPSIS THALIANA PLASMA-ME...		Potri.003G157100 [exp]	13.49	0.8212
AT4G27190			NB-ARC domain-containing disea...		Potri.019G036875 [exp]	16.09	0.8334
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Potri.003G046800 [exp]	17.60	0.7894
AT3G21880	CO	COL12	B-box type zinc finger protein...		Potri.007G121200 [exp]	17.83	0.8471	COL13.2
AT1G07630		PLL5	pol-like 5 (.1)		Potri.006G085000 [exp]	18.81	0.8339
AT4G23980	ARF	ARF9	auxin response factor 9 (.1.2)		Potri.001G088600 [exp]	18.97	0.8254
AT1G17050		SPS2	solanesyl diphosphate synthase...		Potri.011G101301 [exp]	23.23	0.8013

Compare expression of checked genes

Potri.018G029100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.