Potri.018G030700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55190 424 / 3e-153 RAN3, ATRAN3 RAN GTPase 3 (.1)
AT5G20010 420 / 9e-152 ATRAN1, RAN-1 ARABIDOPSIS THALIANA RAS-RELATED NUCLEAR PROTEIN, RAS-related nuclear protein-1 (.1)
AT5G20020 405 / 5e-146 RAN2 RAS-related GTP-binding nuclear protein 2 (.1)
AT5G55080 302 / 5e-105 ATRAN4 ras-related nuclear protein 4 (.1)
AT4G39890 107 / 1e-28 AtRABH1c RAB GTPase homolog H1C (.1)
AT2G44610 100 / 3e-26 RAB6, AtRABH1b, AtRab6A Ras-related small GTP-binding family protein (.1)
AT1G07410 100 / 3e-26 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
AT4G19640 100 / 4e-26 ATRAB-F2B, ARA7, Ara-7, AtRABF2b, AtRab5B ARABIDOPSIS RAB GTPASE HOMOLOG F2B, Ras-related small GTP-binding family protein (.1)
AT5G45130 100 / 5e-26 ATRAB-F2A, RHA1, AtRab5A, AtRABF2a ARABIDOPSIS RAB HOMOLOG F2A, RAB homolog 1 (.1)
AT5G39620 100 / 7e-26 AtRABG1 RAB GTPase homolog G1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G030900 435 / 1e-157 AT5G55190 424 / 3e-153 RAN GTPase 3 (.1)
Potri.006G250300 431 / 3e-156 AT5G55190 424 / 4e-153 RAN GTPase 3 (.1)
Potri.006G250400 411 / 3e-148 AT5G55190 411 / 3e-148 RAN GTPase 3 (.1)
Potri.003G086700 102 / 8e-27 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1)
Potri.002G135500 101 / 1e-26 AT2G44610 385 / 3e-138 Ras-related small GTP-binding family protein (.1)
Potri.019G092500 100 / 4e-26 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.005G073000 100 / 4e-26 AT5G65270 402 / 1e-144 RAB GTPase homolog A4A (.1)
Potri.013G123600 100 / 5e-26 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.010G197200 100 / 9e-26 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019420 417 / 8e-149 AT5G55190 443 / 8e-159 RAN GTPase 3 (.1)
Lus10019441 408 / 8e-147 AT5G55190 434 / 2e-157 RAN GTPase 3 (.1)
Lus10043297 404 / 3e-145 AT5G55190 430 / 1e-155 RAN GTPase 3 (.1)
Lus10043276 402 / 2e-142 AT5G55190 428 / 9e-153 RAN GTPase 3 (.1)
Lus10025432 100 / 5e-26 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10004687 100 / 7e-26 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Lus10040255 100 / 7e-26 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Lus10001026 100 / 1e-25 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Lus10015297 100 / 1e-25 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10017679 99 / 3e-25 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00025 Arf ADP-ribosylation factor family
Representative CDS sequence
>Potri.018G030700.1 pacid=42800686 polypeptide=Potri.018G030700.1.p locus=Potri.018G030700 ID=Potri.018G030700.1.v4.1 annot-version=v4.1
ATGGCTTTGCCGAATCAGCAAACTGTTGATTATCCAAGCTTCAAGCTTGTAATTGTTGGTGATGGTGGTACAGGAAAGACCACATTCGTTAAGAGGCATC
TTACCGGAGAGTTCGAGAAGAAATACGAGCCAACTATTGGTGTGGAAGTGCACCCCTTGGATTTCTTCACTAACTGTGGCAAAATTAGATTCTATTGCTG
GGATACAGCTGGTCAAGAGAAGTTTGGTGGTCTTCGAGATGGATACTACATCCATGGTAATTGTGCTATCATCATGTTTGATGTCACTGCTCGGTTGACA
TACAAGAATGTCCCTACATGGCACAGGGATCTTTGCAGGGTCTGTGAAAACATTCCAATTGTTCTTTGTGGAAACAAGGTGGATGTGAAGAACAGGCAGG
TGAAGGCAAAGCAGGTTACGTTTCACAGGAAGAAGAACCTGCAATACTATGAGATTTCAGCTAAGAGCAATTATAATTTTGAGAAGCCATTCTTGTACCT
TGCCAGAAAACTTGCTGGGGATCCTAACTTGCATTTTGTTGAGACTCCTGCCTTGGCTCCCCCAGAAGTGCCTATCGACCTTGTAGCCCAAGCACAGCAT
GAGGCTGAACTTGCTGCTGCTGCTAGTCAACCTCTTCCAGATGATGACGATGATGCATTTGAATAA
AA sequence
>Potri.018G030700.1 pacid=42800686 polypeptide=Potri.018G030700.1.p locus=Potri.018G030700 ID=Potri.018G030700.1.v4.1 annot-version=v4.1
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGNCAIIMFDVTARLT
YKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVETPALAPPEVPIDLVAQAQH
EAELAAAASQPLPDDDDDAFE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Potri.018G030700 0 1
AT2G31200 ADF6, ATADF6 actin depolymerizing factor 6 ... Potri.002G038800 1.00 0.8705 Pt-ADF6.3
AT4G15802 AtHSBP Arabidopsis thaliana heat shoc... Potri.010G025000 6.63 0.7945
AT1G74520 ATHVA22A HVA22 homologue A (.1) Potri.015G062800 9.05 0.8277
AT1G78815 LSH7 LIGHT SENSITIVE HYPOCOTYLS 7, ... Potri.001G390900 10.95 0.7454
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.001G236700 11.74 0.8068 ADF1,Pt-ADF.5
AT3G48880 RNI-like superfamily protein (... Potri.016G019500 13.96 0.7485
Potri.001G129500 16.49 0.7437
AT1G13380 Protein of unknown function (D... Potri.008G120900 20.83 0.7641
AT4G09890 Protein of unknown function (D... Potri.005G195800 20.97 0.7542
AT4G35300 TMT2 tonoplast monosaccharide trans... Potri.005G098900 21.97 0.7317

Potri.018G030700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.