Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30380 57 / 3e-11 EXLB2 Barwin-related endoglucanase (.1) AT2G18660 55 / 2e-10 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1) AT4G17030 39 / 0.0005 ATHEXPBETA3.1, ATEXPR1, AT-EXPR, ATEXLB1 expansin-like B1 (.1) AT3G45970 39 / 0.0006 ATHEXPBETA2.1, ATEXPL1, ATEXLA1 EXPANSIN L1, expansin-like A1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G249500 [exp] 211 / 1e-71 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1) Potri.006G155000 [exp] 160 / 1e-51 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1) Potri.018G029100 [exp] 105 / 3e-30 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1) Potri.006G252200 [exp] 102 / 8e-29 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1) Potri.003G218300 [exp] 80 / 9e-20 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1) Potri.018G098200 [exp] 79 / 1e-19 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1) Potri.018G101600 [exp] 71 / 2e-16 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1) Potri.006G179300 [exp] 71 / 2e-16 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1) Potri.006G176300 [exp] 63 / 2e-13 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013118 [exp] 166 / 1e-53 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1) Lus10019444 [exp] 149 / 7e-47 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1) Lus10033054 [exp] 140 / 2e-43 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1) Lus10030078 [exp] 96 / 5e-26 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1) Lus10017763 [exp] 86 / 1e-22 ND 35 / 0.001 Lus10042435 [exp] 73 / 4e-17 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1) Lus10019978 [exp] 64 / 1e-13 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1) Lus10026232 [exp] 60 / 8e-12 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1) Lus10020130 [exp] 59 / 3e-11 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1) Lus10026930 [exp] 54 / 4e-09 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [poplar] [flax] DPBB PF03330 [poplar] [flax] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Potri.018G031901.6 pacid=42801685 polypeptide=Potri.018G031901.6.p locus=Potri.018G031901 ID=Potri.018G031901.6.v4.1 annot-version=v4.1 ATGCCAACACTCGGGAAGACCTCTCCATTTCTACTCTTATTGCTCCTAGCAACACTCTTCCATCTCTCACATGGCGATGTGGGCACCTGTTCCCACTACA GACCCCCATATTTACCCACTGCCTGTTATGGGAATTCATCATCACATTTCCCATCAAGCAATCTGTTTGCCGCGGCCGGCGAGGGAATATGGGACAATGG CGCCGCCTGTGGAAGACAGTACCTGGTGAGATGCATCAGTGCAGCTGTCCCGAGAACTTGTCTTCCAGACCAAATCATCCAGGTTAGGATTGTTGATCGA GCACAAACATCAAGGTCAAGGCCTTCATCGAATGGGGCTACGATAGTCCTCTCTTCTACCGCTTTTGGCAGCATCGCAGATCCTTCGGCAAGATTGGTTA ACGTAGAATTCCAACAGGTTTGA
AA sequence Show only first row Show all	>Potri.018G031901.6 pacid=42801685 polypeptide=Potri.018G031901.6.p locus=Potri.018G031901 ID=Potri.018G031901.6.v4.1 annot-version=v4.1 MPTLGKTSPFLLLLLLATLFHLSHGDVGTCSHYRPPYLPTACYGNSSSHFPSSNLFAAAGEGIWDNGAACGRQYLVRCISAAVPRTCLPDQIIQVRIVDR AQTSRSRPSSNGATIVLSSTAFGSIADPSARLVNVEFQQV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Potri.018G031901 [exp]	0	1
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Potri.017G038100 [exp]	2.82	0.8949
AT1G17430			alpha/beta-Hydrolases superfam...		Potri.001G168600 [exp]	5.47	0.8850
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182000 [exp]	5.47	0.8759
AT2G44260			Plant protein of unknown funct...		Potri.001G232500 [exp]	5.65	0.8850
AT1G20180			Protein of unknown function (D...		Potri.005G193000 [exp]	7.48	0.8498
AT3G22470			Pentatricopeptide repeat (PPR)...		Potri.016G025600 [exp]	9.48	0.8271
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182321 [exp]	10.39	0.8428
AT2G16050			Cysteine/Histidine-rich C1 dom...		Potri.010G204600 [exp]	10.48	0.8399
AT2G44260			Plant protein of unknown funct...		Potri.009G025102 [exp]	13.41	0.8385
AT2G27480			Calcium-binding EF-hand family...		Potri.004G202200 [exp]	14.83	0.8139

Compare expression of checked genes

Potri.018G031901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.