Potri.018G035450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.018G035450.1 pacid=42801423 polypeptide=Potri.018G035450.1.p locus=Potri.018G035450 ID=Potri.018G035450.1.v4.1 annot-version=v4.1
ATGGAGGGTGTATTTGACATTTCCCCATCCTGTAGAAATTTTAAAAATCCCGCTGTATACTTGTATAGATTCCCTCAACTTCACGCTCCCTCTGGCTCCA
CACCCAGCAAACTCTCTCTCTCGCTTTCTCAAAAAGAAGCTTTTAAAAAATCTCTGCAAGGGCGACTCCTGCACCAAGCGAGCTCAATCCTAGCCTTCTT
CTTCCTGCTCCTTCATCATAATCTCTTCTCTCGTTTACGATACGTCACCGCAGTTTCTGATGGGAGTGGATAA
AA sequence
>Potri.018G035450.1 pacid=42801423 polypeptide=Potri.018G035450.1.p locus=Potri.018G035450 ID=Potri.018G035450.1.v4.1 annot-version=v4.1
MEGVFDISPSCRNFKNPAVYLYRFPQLHAPSGSTPSKLSLSLSQKEAFKKSLQGRLLHQASSILAFFFLLLHHNLFSRLRYVTAVSDGSG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.018G035450 0 1
Potri.010G183951 7.07 0.7171
AT1G63690 ATSPPL2 SIGNAL PEPTIDE PEPTIDASE-LIKE ... Potri.003G128500 31.46 0.7030
Potri.011G108200 32.66 0.6173
AT5G09310 unknown protein Potri.007G106200 33.88 0.6693
Potri.012G127000 39.23 0.6696
Potri.010G015666 41.71 0.6962
AT3G54190 Transducin/WD40 repeat-like su... Potri.013G091800 42.26 0.6527
AT5G14240 Thioredoxin superfamily protei... Potri.017G066200 43.01 0.6714
AT2G45640 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18... Potri.014G074000 45.36 0.6799
Potri.019G024466 49.65 0.6822

Potri.018G035450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.