Plant FIBer expression Database

Pt-PBG1.1 (Potri.018G037700) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-PBG1.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56450 407 / 5e-146 PBG1 20S proteasome beta subunit G1 (.1)
AT4G31300 55 / 5e-09 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT4G14800 42 / 0.0002 PBD2 20S proteasome beta subunit D2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G242000
[exp]
483 / 8e-176 AT1G56450 399 / 1e-142 20S proteasome beta subunit G1 (.1)
Potri.010G084800
[exp]
51 / 1e-07 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1)
Potri.008G155500
[exp]
49 / 5e-07 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1)
Potri.006G077900
[exp]
49 / 8e-07 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036124
[exp]
431 / 4e-155 AT1G56450 426 / 4e-153 20S proteasome beta subunit G1 (.1)
Lus10011640
[exp]
430 / 8e-155 AT1G56450 427 / 8e-154 20S proteasome beta subunit G1 (.1)
Lus10041194
[exp]
44 / 4e-05 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1)
Lus10039351
[exp]
42 / 0.0001 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1)
Lus10021909
[exp]
42 / 0.0002 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Potri.018G037700.1 pacid=42800693 polypeptide=Potri.018G037700.1.p locus=Potri.018G037700 ID=Potri.018G037700.1.v4.1 annot-version=v4.1
ATGGGGTCTAGTTCTGAAACCAAACAGAACAGCCTTTTGAGCTCTGAACCTGGCATTCAAAGAACCCAGTATCCATATGTGACTGGGTCATCTGTTGTTG
CTTTGAAATATAAAGATGGGATTTTAATGGCTGCTGATATGGGAGGTTCTTATGGGTCCACGCTGCGATACAAGAGTGTGGAGAGAATTAAGCCTGTTGG
GAAGCATTCTCTTATTGGTGCTAGTGGAGAAATAAGTGATTTTCAGGAGATTATGCGTTATCTTGATGAGCAAGTCTTGAATGACAATATGTGGGATGAT
GGAAACTCTTTGGGGCCTAAAGAGATTCACAGCTATTTGACCCGAGTTATGTATAATAGGCGTAACAAGTTTGACCCGCTTTGGAATACACTTCTTCTTG
GTGGTGTGAAAAAAGGACAAAAATTTCTTGGCATGGTCACTATGATAGGAGTAAACTTTGAGGAGAATCATGTAGCAACTGGATTTGGAAATCACATGGC
ACAGCCAATACTTCGTTCTGAGTGGCATGAGAACTTGACCTTTGAAGAAGGTGTTGCATTACTGGAGAAATGTATGCGAGTACTTCTGTATCGTGATAGG
TCTGCTGTGAACAAGTTTCAGATAGCTAAGATTACTGAAGAAGGTGTAACAATTTCACAGCCTTACGCATTGAAGACGTTCTGGGGATTCAAGGCATTTG
AGAATCCAACTGCTGGTGCCGAGGGATCATGGTAG
AA sequence
>Potri.018G037700.1 pacid=42800693 polypeptide=Potri.018G037700.1.p locus=Potri.018G037700 ID=Potri.018G037700.1.v4.1 annot-version=v4.1
MGSSSETKQNSLLSSEPGIQRTQYPYVTGSSVVALKYKDGILMAADMGGSYGSTLRYKSVERIKPVGKHSLIGASGEISDFQEIMRYLDEQVLNDNMWDD
GNSLGPKEIHSYLTRVMYNRRNKFDPLWNTLLLGGVKKGQKFLGMVTMIGVNFEENHVATGFGNHMAQPILRSEWHENLTFEEGVALLEKCMRVLLYRDR
SAVNKFQIAKITEEGVTISQPYALKTFWGFKAFENPTAGAEGSW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G56450 PBG1 20S proteasome beta subunit G1... Potri.018G037700
[exp]
0 1 Pt-PBG1.1
AT3G26340 N-terminal nucleophile aminohy... Potri.008G177000
[exp]
2.00 0.8663 Pt-PBE1.2
AT1G56450 PBG1 20S proteasome beta subunit G1... Potri.006G242000
[exp]
2.00 0.8591
AT4G29040 RPT2A regulatory particle AAA-ATPase... Potri.002G252600
[exp]
3.46 0.8458 Pt-RPT2.2
AT1G30580 GTP binding (.1) Potri.011G164000
[exp]
5.91 0.8381
AT3G51260 PAD1 20S proteasome alpha subunit ... Potri.004G174200
[exp]
6.00 0.8456 Pt-PAD1.2
AT3G27430 PBB1 N-terminal nucleophile aminohy... Potri.004G066000
[exp]
7.48 0.8340 Pt-PBB1.2
AT1G53750 RPT1A regulatory particle triple-A 1... Potri.006G216600
[exp]
10.00 0.8431 RPT1.5
AT5G10780 unknown protein Potri.006G266300
[exp]
10.95 0.7713
AT1G67250 Proteasome maturation factor U... Potri.017G111900
[exp]
11.22 0.8414
AT3G17300 EMB2786 unknown protein Potri.010G152100
[exp]
13.41 0.7388

Potri.018G037700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.