Potri.018G038900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11175 110 / 1e-31 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G241100 254 / 2e-88 AT4G11175 109 / 2e-31 Nucleic acid-binding, OB-fold-like protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035773 169 / 1e-54 AT4G11175 108 / 3e-31 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10037352 160 / 2e-51 AT4G11175 107 / 2e-30 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF01176 eIF-1a Translation initiation factor 1A / IF-1
Representative CDS sequence
>Potri.018G038900.1 pacid=42802119 polypeptide=Potri.018G038900.1.p locus=Potri.018G038900 ID=Potri.018G038900.1.v4.1 annot-version=v4.1
ATGACCTCAACAACAGCAGCAACTCAAATTCATGCTCTAACTGCAACTGGGTTCTCAACAAAACCTACCAATCTTTCTCCATCAACAGTCTTCTTCAGCC
AATCACTCACCAAAACGACACACTCCTTTGGCCTTATTGCTACAACACCAACAATTTCAAGGTTTCCTGTTTCTACCAATGCAAAGGCCAATCCAACTGG
AGAACAGAAATGGACCCATGAAGGCTCTGTCACTGAATCACTACCTAATGGTATGTTTCGGGTTCGCCTAGACAACAAAGATTTAATTATTGGTTATATC
TCTGGTAAGATACGCAAGAATTTTGTTCGGATTTTGCCAGGAGATAGAGTCAAGGTTGAAGTAAGTCGTTATGATTCGAGTAGAGGACGTATTGTTTATA
GACTCCGCAATAGAGACCCGACTAGTGAATGA
AA sequence
>Potri.018G038900.1 pacid=42802119 polypeptide=Potri.018G038900.1.p locus=Potri.018G038900 ID=Potri.018G038900.1.v4.1 annot-version=v4.1
MTSTTAATQIHALTATGFSTKPTNLSPSTVFFSQSLTKTTHSFGLIATTPTISRFPVSTNAKANPTGEQKWTHEGSVTESLPNGMFRVRLDNKDLIIGYI
SGKIRKNFVRILPGDRVKVEVSRYDSSRGRIVYRLRNRDPTSE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G11175 Nucleic acid-binding, OB-fold-... Potri.018G038900 0 1
AT3G54210 Ribosomal protein L17 family p... Potri.006G113500 3.00 0.9832
AT2G01870 unknown protein Potri.001G257400 3.16 0.9829
AT3G61870 unknown protein Potri.014G102400 6.92 0.9791
AT2G47485 unknown protein Potri.002G200000 7.74 0.9731
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Potri.010G127300 8.06 0.9757
AT3G18870 Mitochondrial transcription te... Potri.004G150600 8.48 0.9757
AT1G54500 Rubredoxin-like superfamily pr... Potri.005G049000 8.71 0.9758
AT4G24770 CP31, ATRBP33, ... ARABIDOPSIS THALIANA RNA BINDI... Potri.015G086500 9.38 0.9726 CTRNP.1
AT5G52960 unknown protein Potri.012G033700 10.39 0.9745
AT2G44760 Domain of unknown function (DU... Potri.002G138600 10.95 0.9679

Potri.018G038900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.