Potri.018G039701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11550 39 / 0.0006 ARM repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G240400 88 / 3e-21 AT5G11550 179 / 1e-53 ARM repeat superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.018G039701.1 pacid=42800546 polypeptide=Potri.018G039701.1.p locus=Potri.018G039701 ID=Potri.018G039701.1.v4.1 annot-version=v4.1
ATGAATGCACATAAACTAATCTTAGTCCCACCACTCCTAACCCACCTTTTCTCCCTCTACCTCCCACCACAACAAGCACCACCACCACATCCTCCCCAGC
AACATTCTAACCAACCCCACCAAAAATCCCCTCAAGCTGAATCCTCTTCCTCCTCCTCCTCCACTTCAACCTCTCAAAGCTTCACCCAAGGCAGATTCCC
TCTCTCAAACTCCCCACCCCACCAACCCAAACGTCCTAAACCTGACCTGAATCAACGCTCCACCTTCTTACAACAATTGGCACCACTAGTGCAGTCCACC
AACCTCCAAGAACTCCTCCACATGGCTGAGCTGCAACTTACCAAAGGCTTGGAATCCGAGCAACTTTCTGCTCTATATTTTCTCGAACATTCACTCGTAT
CCGACGCGCCATCACACCAGGTTTGCTCAGTACCCGAATTAATACGCGGGTGGTGGCAAATTTGA
AA sequence
>Potri.018G039701.1 pacid=42800546 polypeptide=Potri.018G039701.1.p locus=Potri.018G039701 ID=Potri.018G039701.1.v4.1 annot-version=v4.1
MNAHKLILVPPLLTHLFSLYLPPQQAPPPHPPQQHSNQPHQKSPQAESSSSSSSTSTSQSFTQGRFPLSNSPPHQPKRPKPDLNQRSTFLQQLAPLVQST
NLQELLHMAELQLTKGLESEQLSALYFLEHSLVSDAPSHQVCSVPELIRGWWQI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.018G039701 0 1
AT2G37960 unknown protein Potri.016G109100 37.10 0.5797
Potri.006G023450 69.45 0.6612
AT4G01590 unknown protein Potri.014G085200 84.25 0.6653
Potri.004G099900 111.23 0.6442
AT5G17440 LUC7 related protein (.1) Potri.019G055000 137.24 0.6174
AT4G38190 ATCSLD4 ARABIDOPSIS THALIANA CELLULOSE... Potri.004G208800 146.66 0.5705 Pt-ATCSLD4.2
AT4G19950 unknown protein Potri.005G184600 181.95 0.5467

Potri.018G039701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.