Potri.018G043850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.018G043850.1 pacid=42800636 polypeptide=Potri.018G043850.1.p locus=Potri.018G043850 ID=Potri.018G043850.1.v4.1 annot-version=v4.1
ATGTCGTGGTTGAAAATCAGCCAATCTGTTATTCGGCTGGCGGTACTTGCGAAGTTTGTTAAGAGTTCCGTAGCACTCTATTGGGATGAGGAAATGCTTA
TACAGTGGCTCAAGTACAAATCAATCTTACTCACAGCGCGATCATTGTCAGTGGGCATAATGATGCCAAAATTTACAGCCATCGCTAGCTAG
AA sequence
>Potri.018G043850.1 pacid=42800636 polypeptide=Potri.018G043850.1.p locus=Potri.018G043850 ID=Potri.018G043850.1.v4.1 annot-version=v4.1
MSWLKISQSVIRLAVLAKFVKSSVALYWDEEMLIQWLKYKSILLTARSLSVGIMMPKFTAIAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.018G043850 0 1
Potri.005G192050 14.28 0.7319
AT1G17060 SHK1, CHI2, SOB... SUPPRESSOR OF PHYB-4 7, SHRINK... Potri.017G000600 24.12 0.7637
AT2G32440 ATKAO2, CYP88A4... ARABIDOPSIS ENT-KAURENOIC ACID... Potri.001G144933 24.24 0.7311
Potri.008G139250 25.29 0.7240
AT3G07870 F-box and associated interacti... Potri.010G207401 29.93 0.6046
AT3G13440 S-adenosyl-L-methionine-depend... Potri.003G157201 30.00 0.6018
AT5G42120 Concanavalin A-like lectin pro... Potri.007G062462 41.41 0.6173
Potri.001G383801 42.42 0.6234
Potri.002G111832 42.77 0.6904
Potri.002G047750 45.43 0.6871

Potri.018G043850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.