Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25770 187 / 2e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) AT4G32870 129 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G01026 48 / 5e-07 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT5G53160 47 / 8e-07 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT1G01360 46 / 2e-06 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT2G26040 45 / 6e-06 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT4G27920 42 / 4e-05 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G237000 [exp] 155 / 1e-48 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.006G236800 [exp] 151 / 1e-46 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.006G237100 [exp] 143 / 7e-44 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G063900 [exp] 78 / 2e-18 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.010G193200 [exp] 56 / 8e-11 AT2G25770 59 / 4e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) Potri.014G097100 [exp] 49 / 1e-07 AT1G01360 301 / 6e-106 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.002G169400 [exp] 49 / 2e-07 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.003G139200 [exp] 49 / 2e-07 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.015G020500 [exp] 47 / 6e-07 AT5G53160 304 / 7e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005477 [exp] 204 / 4e-68 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) Lus10026898 [exp] 148 / 3e-46 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) Lus10006042 [exp] 120 / 7e-35 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10000573 [exp] 115 / 5e-33 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10028262 [exp] 67 / 2e-14 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) Lus10040227 [exp] 67 / 5e-14 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) Lus10014929 [exp] 51 / 6e-08 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10038818 [exp] 50 / 1e-07 AT5G53160 287 / 1e-99 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10001059 [exp] 50 / 1e-07 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10040916 [exp] 50 / 1e-07 AT1G01360 265 / 1e-91 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF10604 [poplar] [flax] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Potri.018G046100.1 pacid=42801185 polypeptide=Potri.018G046100.1.p locus=Potri.018G046100 ID=Potri.018G046100.1.v4.1 annot-version=v4.1 ATGGAGCAAGATCCACAGCCAAAATGGGAAGGCAAGGTCTCAGAAAGGCTACCAAAAGCCACAGCAGATCAAATATGGCCTCTCCTCAACGACTTCTTTA ACCTCCACAAATGGTTTCCTAGCCTTGCCACCTGCTATGGCATCCATGGGACTAATGGTGAGCCAGGTTGCATAAGACACTGTGAGGGCTCCTCGATTCC GTCCACTGACACCAATACAGATGGCCACAGTCAGCCTGTTAGCTGGTCCTCTGAGAGATTAACAGTTGTTGATCATGTTGAACGTAGCTTGAGCTATGAG ATAGTTGACAGCAATATTGGGTTCAAGTCATATGTTTCAACGGTCAAGGTTGTCCCACAAGGTGATGATGGTCAAGATGGGTGTGTGATCGAATGGTCAT TCAATGTTGATCCAGTGGCAGGGTTGGTATTGGATGAGCTGGTGAGAAAGTATAAAGTGGGACTGCAGCAAATGGCCGAGAGACTGGAGGATGCAGTTAA AGGTTTTTAA
AA sequence Show only first row Show all	>Potri.018G046100.1 pacid=42801185 polypeptide=Potri.018G046100.1.p locus=Potri.018G046100 ID=Potri.018G046100.1.v4.1 annot-version=v4.1 MEQDPQPKWEGKVSERLPKATADQIWPLLNDFFNLHKWFPSLATCYGIHGTNGEPGCIRHCEGSSIPSTDTNTDGHSQPVSWSSERLTVVDHVERSLSYE IVDSNIGFKSYVSTVKVVPQGDDGQDGCVIEWSFNVDPVAGLVLDELVRKYKVGLQQMAERLEDAVKGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G25770			Polyketide cyclase/dehydrase a...		Potri.018G046100 [exp]	0	1
AT3G42170			BED zinc finger ;hAT family di...		Potri.017G019466 [exp]	4.00	0.9394
					Potri.007G142700 [exp]	5.38	0.8881
AT4G14210		PDE226, PDS3	PIGMENT DEFECTIVE 226, phytoen...		Potri.002G235200 [exp]	6.00	0.9168	PDS.2
AT5G05800			unknown protein		Potri.001G243108 [exp]	7.00	0.9233
AT5G51170			unknown protein		Potri.015G111628 [exp]	9.16	0.9022
AT5G36930			Disease resistance protein (TI...		Potri.011G008228 [exp]	10.95	0.9249
					Potri.003G070000 [exp]	13.19	0.8678
AT1G09240		ATNAS3	ARABIDOPSIS THALIANA NICOTIANA...		Potri.010G143100 [exp]	14.00	0.8146
					Potri.004G019766 [exp]	17.32	0.8997
AT5G17680			disease resistance protein (TI...		Potri.019G070651 [exp]	17.60	0.9159

Compare expression of checked genes

Potri.018G046100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.