Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20885 136 / 4e-41 RING/U-box superfamily protein (.1) AT3G43430 123 / 5e-36 RING/U-box superfamily protein (.1) AT5G41400 64 / 5e-13 RING/U-box superfamily protein (.1) AT4G00305 63 / 5e-13 RING/U-box superfamily protein (.1) AT3G61460 60 / 1e-11 BRH1 brassinosteroid-responsive RING-H2 (.1) AT1G63840 57 / 2e-10 RING/U-box superfamily protein (.1) AT2G47560 57 / 4e-10 RING/U-box superfamily protein (.1) AT3G62690 57 / 4e-10 ATL5 AtL5 (.1) AT2G42360 57 / 5e-10 RING/U-box superfamily protein (.1) AT5G58580 57 / 8e-10 ATL63 TOXICOS EN LEVADURA 63 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G217000 [exp] 237 / 5e-81 AT5G20885 138 / 8e-42 RING/U-box superfamily protein (.1) Potri.014G087700 [exp] 68 / 1e-14 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1) Potri.001G101000 [exp] 62 / 2e-12 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1) Potri.002G161900 [exp] 62 / 3e-12 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1) Potri.011G150800 [exp] 61 / 5e-12 AT3G61460 69 / 1e-14 brassinosteroid-responsive RING-H2 (.1) Potri.003G130900 [exp] 61 / 1e-11 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1) Potri.010G133300 [exp] 59 / 2e-11 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1) Potri.010G133200 [exp] 59 / 2e-11 AT3G61460 69 / 3e-15 brassinosteroid-responsive RING-H2 (.1) Potri.019G091400 [exp] 59 / 7e-11 AT2G42360 143 / 9e-42 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043353 [exp] 135 / 2e-40 AT5G20885 157 / 4e-49 RING/U-box superfamily protein (.1) Lus10019507 [exp] 134 / 4e-40 AT5G20885 162 / 5e-51 RING/U-box superfamily protein (.1) Lus10028773 [exp] 66 / 1e-13 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1) Lus10017510 [exp] 63 / 1e-12 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1) Lus10032290 [exp] 61 / 1e-11 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1) Lus10016541 [exp] 59 / 3e-11 AT5G57750 68 / 2e-14 RING/U-box superfamily protein (.1) Lus10024657 [exp] 59 / 5e-11 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1) Lus10002194 [exp] 59 / 1e-10 AT2G42360 153 / 4e-46 RING/U-box superfamily protein (.1) Lus10008283 [exp] 58 / 1e-10 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1) Lus10031515 [exp] 58 / 3e-10 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.018G046900.3 pacid=42801767 polypeptide=Potri.018G046900.3.p locus=Potri.018G046900 ID=Potri.018G046900.3.v4.1 annot-version=v4.1 ATGGGCTTCTTTGCAGAAGAGTCAGGGTTAATAGTAGCCCATCTTATCTACAAGGCAGCTCTTGCTTTAGCAGTCTTGATATGGGCCTGGGACTGGGCTC TGAGATTTAAGAACAGAGCCCATTTATCCTCCTCTAGCAATGATTCTCTACAGCAATATCATCCTGTTCCTTCTCCACATCAAGTTATGGACGGTCTGAT TTCGACCACTTTCAATGACGTCATAGAGAGGGTGCCAGGGGTTTGTGACACATGTGCTGTCTGCTTGAGCCAGTTGAGGGATCAAGATGAGGTCAGAGAG TTGAGGAACTGCGGCCACGTGTTCCATAAGGAGTGCATAGATAGATGGGTAGATCATGATCATGATCACGATCACGATCACGATCATGACGAGAATCACA ATACCTGCCCACTGTGCAGGGCACCGTTGCCGACAACCTCACGAAGTCTGGCTTGGACCAGGACTGAGCCTAGTTGGGCCGTTGAGAGAATTCTCTACCT CTTCGGGGATGATTTGATTACGTGA
AA sequence Show only first row Show all	>Potri.018G046900.3 pacid=42801767 polypeptide=Potri.018G046900.3.p locus=Potri.018G046900 ID=Potri.018G046900.3.v4.1 annot-version=v4.1 MGFFAEESGLIVAHLIYKAALALAVLIWAWDWALRFKNRAHLSSSSNDSLQQYHPVPSPHQVMDGLISTTFNDVIERVPGVCDTCAVCLSQLRDQDEVRE LRNCGHVFHKECIDRWVDHDHDHDHDHDHDENHNTCPLCRAPLPTTSRSLAWTRTEPSWAVERILYLFGDDLIT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20885			RING/U-box superfamily protein...		Potri.018G046900 [exp]	0	1
					Potri.014G044600 [exp]	6.32	0.7733
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Potri.017G018801 [exp]	15.29	0.8420
AT1G74470			Pyridine nucleotide-disulphide...		Potri.009G157700 [exp]	21.81	0.7770
AT5G46940			Plant invertase/pectin methyle...		Potri.005G023100 [exp]	22.44	0.8151
AT5G46940			Plant invertase/pectin methyle...		Potri.005G023050 [exp]	27.27	0.8035
AT5G46940			Plant invertase/pectin methyle...		Potri.005G023201 [exp]	30.98	0.8095
AT2G25940		ALPHAVPE, ALPHA...	alpha-vacuolar processing enzy...		Potri.008G003400 [exp]	31.30	0.7545
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Potri.001G080000 [exp]	37.09	0.8114
AT3G54490		RPB5E	"RNA polymerase II fifth large...		Potri.003G200450 [exp]	43.63	0.7972
AT3G50150			Plant protein of unknown funct...		Potri.016G039200 [exp]	54.49	0.7775

Compare expression of checked genes

Potri.018G046900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.