Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26210 217 / 7e-71 Ankyrin repeat family protein (.1.2.3) AT3G58760 51 / 4e-07 Integrin-linked protein kinase family (.1) AT4G18950 50 / 1e-06 Integrin-linked protein kinase family (.1) AT5G02620 49 / 3e-06 ATANK1, ANK1 ankyrin-like1 (.1) AT5G37500 46 / 2e-05 GORK gated outwardly-rectifying K+ channel, gated outwardly-rectifying K+ channel (.1) AT3G03790 45 / 3e-05 ankyrin repeat family protein / regulator of chromosome condensation (RCC1) family protein AT5G66055 45 / 4e-05 EMB16, EMB2036, AKRP EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) AT3G16940 43 / 0.0002 CAMTA calmodulin binding;transcription regulators (.1) AT2G31800 43 / 0.0002 Integrin-linked protein kinase family (.1) AT3G02850 42 / 0.0004 SKOR STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G217100 [exp] 465 / 2e-167 AT2G26210 209 / 8e-68 Ankyrin repeat family protein (.1.2.3) Potri.005G105800 [exp] 49 / 1e-06 AT5G66055 457 / 3e-159 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Potri.017G135400 [exp] 49 / 3e-06 AT3G02850 1269 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Potri.004G064400 [exp] 48 / 4e-06 AT4G18950 632 / 0.0 Integrin-linked protein kinase family (.1) Potri.010G185200 [exp] 47 / 7e-06 AT2G03430 76 / 3e-15 Ankyrin repeat family protein (.1) Potri.009G070700 [exp] 44 / 2e-05 AT5G12320 197 / 6e-66 ankyrin repeat family protein (.1) Potri.001G333600 [exp] 45 / 4e-05 AT5G14230 975 / 0.0 unknown protein Potri.007G060400 [exp] 45 / 4e-05 AT5G66055 462 / 2e-161 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Potri.001G295200 [exp] 44 / 4e-05 AT5G40160 317 / 4e-108 embryo defective 506, EMBRYO DEFECTIVE 139, Ankyrin repeat family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034882 [exp] 218 / 2e-69 AT2G26210 165 / 2e-50 Ankyrin repeat family protein (.1.2.3) Lus10033419 [exp] 201 / 1e-64 AT2G26210 156 / 5e-49 Ankyrin repeat family protein (.1.2.3) Lus10029277 [exp] 52 / 3e-07 AT4G18950 601 / 0.0 Integrin-linked protein kinase family (.1) Lus10002765 [exp] 47 / 9e-07 AT4G18950 132 / 1e-37 Integrin-linked protein kinase family (.1) Lus10036990 [exp] 50 / 1e-06 AT5G14230 510 / 5e-174 unknown protein Lus10041853 [exp] 48 / 4e-06 AT5G66055 465 / 2e-162 EMBRYO DEFECTIVE 2036, EMBRYO DEFECTIVE 16, ankyrin repeat protein (.1.2) Lus10028039 [exp] 47 / 1e-05 AT3G02850 60 / 1e-17 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10037694 [exp] 47 / 2e-05 AT3G02850 659 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10015687 [exp] 46 / 2e-05 AT3G02850 1231 / 0.0 STELAR K+ outward rectifier, STELAR K+ outward rectifier (.1) Lus10001605 [exp] 45 / 6e-05 AT4G38130 833 / 0.0 ARABIDOPSIS HISTONE DEACETYLASE 19, ARABIDOPSIS HISTONE DEACETYLASE 1, histone deacetylase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0390 [poplar] [flax] zf-FYVE-PHD PF01363 [poplar] [flax] FYVE FYVE zinc finger CL0465 [poplar] [flax] Ank PF13857 [poplar] [flax] Ank_5 Ankyrin repeats (many copies)
Representative CDS sequence Show only first row Show all	>Potri.018G047000.1 pacid=42800787 polypeptide=Potri.018G047000.1.p locus=Potri.018G047000 ID=Potri.018G047000.1.v4.1 annot-version=v4.1 ATGATGTCAACGGAGCCTCCAGCTTTTCAAGAAGCATCTCGCTGTGACGTCTGCAAATGCAGCTTCAACACTTTCCGTCGCCGTCATCATTGCCGTTGTT GCGGAAGGACATTATGCCATGAACACTCGTCAAATCAAATGGCTTTGCCGCAGTTTGGGATACTCTCGAATGCTAGAGTTTGTGCTGATTGTTTTAACAA TTCTACCCGATCAGAGAAAGTTGATGGAGTTGATTCCATAACAGATAAAGTTTCTAGATTAGACATTGATACAGAAAAACATCCAAAACCAGAACCAACA ACACAGAATCAATCTGCTGCAGGTGTTATAGAGTGTAAGTGTGGGATGCCTTTATGCATCTGCGAAGCACCAGCAGCAAAAACAGATCCGGTTCCCAAGC AGGTAAAACTTTCTTCCACCTTCACATCCCAGTCGAATTCAAAACCAAAGAAAACAGATGCTGTTCCGAAGAACAGAGGCTCCACTTCAAGCAGCAAGCC TAGTTCGGTTTTCAATCATGGCCAAATTACAAATGGTGGTGTAGATAAACCTCAGATGGATTATGAAGTCAATGGAGAGGGTTTAAGGGAAGCCATAAAG AATGGTGATACTGTTGCAGTCAAGAAGCTTTTGAGTGAGGGTGTGGATGCAAATTATCGTGATAAGCAAGGAATGTCTTTGCTACATCTGGCTGCACTAT TTAATCGAACTGACATAGCGTTCATCCTTATGGACTCCGGGGCAAGCATGAACTATAAGAATGCGCAAGGGGAAACGCCATTGGACTGCGCTCCTGCAAC TTTGCAGTACAAGATGAAACAGAAAATGGAGGAATGTGGACAACAGGGGCCACATGCCAGTGTTTGA
AA sequence Show only first row Show all	>Potri.018G047000.1 pacid=42800787 polypeptide=Potri.018G047000.1.p locus=Potri.018G047000 ID=Potri.018G047000.1.v4.1 annot-version=v4.1 MMSTEPPAFQEASRCDVCKCSFNTFRRRHHCRCCGRTLCHEHSSNQMALPQFGILSNARVCADCFNNSTRSEKVDGVDSITDKVSRLDIDTEKHPKPEPT TQNQSAAGVIECKCGMPLCICEAPAAKTDPVPKQVKLSSTFTSQSNSKPKKTDAVPKNRGSTSSSKPSSVFNHGQITNGGVDKPQMDYEVNGEGLREAIK NGDTVAVKKLLSEGVDANYRDKQGMSLLHLAALFNRTDIAFILMDSGASMNYKNAQGETPLDCAPATLQYKMKQKMEECGQQGPHASV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G26210			Ankyrin repeat family protein ...		Potri.018G047000 [exp]	0	1
AT1G04990	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.002G223700 [exp]	6.00	0.6690	ZFN2.2
AT3G60300			RWD domain-containing protein ...		Potri.002G138000 [exp]	8.94	0.6561
AT5G17060		ATARFB1B	ADP-ribosylation factor B1B (....		Potri.019G052200 [exp]	13.22	0.7647
AT4G39860			unknown protein		Potri.005G076000 [exp]	14.83	0.6184
AT1G69010	bHLH	bHLH102, BIM2	BES1-interacting Myc-like prot...		Potri.008G112000 [exp]	20.19	0.5667
AT1G09960		ATSUC4, SUC4, A...	sucrose transporter 4 (.1)		Potri.002G106900 [exp]	26.72	0.6818
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.008G095300 [exp]	27.29	0.6695
AT4G02600		MLO1, ATMLO1	MILDEW RESISTANCE LOCUS O 1, S...		Potri.013G069900 [exp]	30.39	0.5568
AT1G54390		ING2	INHIBITOR OF GROWTH 2, PHD fin...		Potri.019G033800 [exp]	35.24	0.6128
AT3G26618		ERF1-3	eukaryotic release factor 1-3 ...		Potri.001G072000 [exp]	42.66	0.6441	ERF1.6

Compare expression of checked genes

Potri.018G047000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.