Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15500 91 / 1e-21 Ankyrin repeat family protein (.1.2) AT5G51160 85 / 2e-19 Ankyrin repeat family protein (.1) AT5G54620 82 / 2e-18 Ankyrin repeat family protein (.1) AT4G10720 81 / 6e-18 Ankyrin repeat family protein (.1.2) AT1G14500 79 / 2e-17 Ankyrin repeat family protein (.1) AT1G14480 73 / 2e-15 Ankyrin repeat family protein (.1.2) AT5G54610 73 / 3e-15 ANK ankyrin (.1) AT5G60070 70 / 4e-14 ankyrin repeat family protein (.1) AT2G24600 65 / 2e-12 Ankyrin repeat family protein (.1.2.3.4) AT2G31820 63 / 7e-12 Ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G223800 [exp] 256 / 2e-84 AT5G51160 176 / 1e-49 Ankyrin repeat family protein (.1) Potri.006G223700 [exp] 202 / 6e-63 AT5G15500 145 / 3e-38 Ankyrin repeat family protein (.1.2) Potri.014G051100 [exp] 143 / 8e-41 AT5G51160 209 / 3e-62 Ankyrin repeat family protein (.1) Potri.015G111300 [exp] 119 / 5e-32 AT5G51160 338 / 2e-112 Ankyrin repeat family protein (.1) Potri.013G017254 [exp] 114 / 5e-30 AT5G51160 151 / 7e-41 Ankyrin repeat family protein (.1) Potri.018G042200 [exp] 111 / 1e-28 AT1G10340 268 / 6e-82 Ankyrin repeat family protein (.1.2) Potri.012G113800 [exp] 108 / 8e-28 AT5G51160 351 / 1e-117 Ankyrin repeat family protein (.1) Potri.001G187600 [exp] 70 / 3e-14 AT5G50140 280 / 3e-86 Ankyrin repeat family protein (.1) Potri.005G069300 [exp] 66 / 7e-13 AT1G07710 695 / 0.0 Ankyrin repeat family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034256 [exp] 145 / 3e-41 AT5G51160 140 / 2e-36 Ankyrin repeat family protein (.1) Lus10029089 [exp] 129 / 7e-37 AT5G51160 104 / 4e-25 Ankyrin repeat family protein (.1) Lus10034255 [exp] 132 / 2e-36 AT5G51160 125 / 4e-31 Ankyrin repeat family protein (.1) Lus10029008 [exp] 125 / 8e-34 AT5G51160 121 / 8e-30 Ankyrin repeat family protein (.1) Lus10029007 [exp] 124 / 2e-33 AT5G51160 128 / 4e-32 Ankyrin repeat family protein (.1) Lus10041537 [exp] 115 / 2e-30 AT5G51160 350 / 2e-117 Ankyrin repeat family protein (.1) Lus10038609 [exp] 100 / 2e-25 AT1G10340 142 / 2e-38 Ankyrin repeat family protein (.1.2) Lus10037894 [exp] 100 / 1e-24 AT1G10340 298 / 3e-93 Ankyrin repeat family protein (.1.2) Lus10024844 [exp] 75 / 8e-16 AT1G34050 353 / 4e-114 Ankyrin repeat family protein (.1) Lus10029006 [exp] 74 / 1e-15 AT5G51160 84 / 1e-17 Ankyrin repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF12796 [poplar] [flax] Ank_2 Ankyrin repeats (3 copies)
Representative CDS sequence Show only first row Show all	>Potri.018G050600.1 pacid=42800343 polypeptide=Potri.018G050600.1.p locus=Potri.018G050600 ID=Potri.018G050600.1.v4.1 annot-version=v4.1 ATGGGGACCCCATTAACCTCCGAAGCAAATTCTTTGCAGAGATTGCTTGAAGAGGATAAGCTTGTTCTTGATGGATTTACTAGAGATTGTTTTGCAGAGA CACCTCTGCACATATCTGCCATGCTTGGACACTTGGAATTTAAAAGAAATATTTCAAGTCAAACACCTGTGTTTGCTAAAGAACTAGATTTCCGCAGAAT ATCTACGCTTCTCTTGGCAACAGCAAATGGGCACCTTGAATTAGTAAAAGCACTGTTACTGGTCAACCCTGACATGTGCTATGCTCAAGATCGAGATGGC CAGAGCCCACTTCATATTGCAGTGATCAAAAGCCGAGTTGATGTCTCGAAAGAATTGGTTCAAACTAAACCTGAGGCCGTTCTTCTCCGGACTGAACGAG GTGAGACCATCCTGCATCTCTGTGTTAAACACTACCAGATAGATGCTTTGAAATTTTTGGTAGAGACAATCAAAGAAAGTGGATTTACCAGTTCTAAGGA TGAGGATGGCTCAACTGTCCTGCAACTAGCAGTAGCCGATAGAGAAATTGAGGTATGA
AA sequence Show only first row Show all	>Potri.018G050600.1 pacid=42800343 polypeptide=Potri.018G050600.1.p locus=Potri.018G050600 ID=Potri.018G050600.1.v4.1 annot-version=v4.1 MGTPLTSEANSLQRLLEEDKLVLDGFTRDCFAETPLHISAMLGHLEFKRNISSQTPVFAKELDFRRISTLLLATANGHLELVKALLLVNPDMCYAQDRDG QSPLHIAVIKSRVDVSKELVQTKPEAVLLRTERGETILHLCVKHYQIDALKFLVETIKESGFTSSKDEDGSTVLQLAVADREIEV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G15500			Ankyrin repeat family protein ...		Potri.018G050600 [exp]	0	1
AT1G71740			unknown protein		Potri.005G198200 [exp]	6.48	0.8249
AT2G23690			unknown protein		Potri.009G110600 [exp]	12.00	0.8018
AT4G35160			O-methyltransferase family pro...		Potri.013G121900 [exp]	16.97	0.8511
					Potri.003G092900 [exp]	38.72	0.8405
AT2G22590			UDP-Glycosyltransferase superf...		Potri.012G034100 [exp]	41.23	0.8309
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G022400 [exp]	42.08	0.8272
AT3G54960		ATPDI1, ATPDIL1...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.010G222100 [exp]	58.24	0.8219
AT1G64160			Disease resistance-responsive ...		Potri.013G142401 [exp]	58.35	0.8225
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Potri.008G160000 [exp]	59.38	0.8047
AT2G16760			Calcium-dependent phosphotries...		Potri.014G120300 [exp]	81.54	0.7821

Compare expression of checked genes

Potri.018G050600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.