Potri.018G052900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11900 290 / 7e-101 Translation initiation factor SUI1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G228100 333 / 3e-118 AT5G11900 308 / 4e-108 Translation initiation factor SUI1 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024986 300 / 5e-105 AT5G11900 326 / 3e-115 Translation initiation factor SUI1 family protein (.1)
Lus10013512 243 / 4e-82 AT5G11900 261 / 1e-89 Translation initiation factor SUI1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01253 SUI1 Translation initiation factor SUI1
Representative CDS sequence
>Potri.018G052900.1 pacid=42801711 polypeptide=Potri.018G052900.1.p locus=Potri.018G052900 ID=Potri.018G052900.1.v4.1 annot-version=v4.1
ATGGCAGAGAAACCTGATCCAGTGAAAGTGTTATACTGCCCAACATGCTCTCTCCCTGCGGAGTATTGTGAATTCGGGTCTGATTTCGAGAAATGCAAAC
CTTGGCTCATCAAAAACGCCCCTGAACTCTACCCTGATCTCCTTAAAGAGGCTGACGAAAAGGAGGCTGGGAGGGTTTCGGAGCAACTGCACTCAGTTGG
AATTTCCTCAATTGGTGCTGATGGGTCAGCTTCTTCTATTCACTCTGGAGAGACATCATCATCTAAGCAAGAAGAAGTGAAAAGGCTTCCAGGTGGCAAA
ATCAAGAAGAAAGTAAGACAAGAAGTTGTAATTGAAAAGGTTGTTCGCAACAAGCGCAAAAGTATCACCATTATTAAAGGATTGGACCTATTTGGTATTA
AATTGAGTGATGCTTCCAAAAAGCTTGGGAAGAAGTTTGCTACTGGAGCATCTGTTGTTAAGGGTCCAACAGAGAAGGAACAGATTGATGTTCAAGGAGA
CATAGCTTACGATATCGTGGAATTTATCACAGAGACTTGGCCTGATGTTCCTGAAACCGCCATTTACTTCATTGAAGATGGGAAAAAGGTTCCAGCTGCT
TGA
AA sequence
>Potri.018G052900.1 pacid=42801711 polypeptide=Potri.018G052900.1.p locus=Potri.018G052900 ID=Potri.018G052900.1.v4.1 annot-version=v4.1
MAEKPDPVKVLYCPTCSLPAEYCEFGSDFEKCKPWLIKNAPELYPDLLKEADEKEAGRVSEQLHSVGISSIGADGSASSIHSGETSSSKQEEVKRLPGGK
IKKKVRQEVVIEKVVRNKRKSITIIKGLDLFGIKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDIAYDIVEFITETWPDVPETAIYFIEDGKKVPAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G11900 Translation initiation factor ... Potri.018G052900 0 1
AT5G51510 unknown protein Potri.012G127100 7.93 0.8888
AT2G23940 Protein of unknown function (D... Potri.018G101100 11.53 0.8752
AT3G53020 RPL24B, STV1 SHORT VALVE1, Ribosomal protei... Potri.015G141900 11.95 0.9012
AT4G21215 unknown protein Potri.010G097100 19.20 0.8494
AT3G12390 Nascent polypeptide-associated... Potri.003G190800 21.02 0.8918
AT4G17510 UCH3 ubiquitin C-terminal hydrolase... Potri.003G081000 22.84 0.8547
AT1G05780 Vacuolar ATPase assembly integ... Potri.001G160500 24.16 0.8026
AT4G16450 unknown protein Potri.006G016300 24.28 0.8844
AT1G32210 ATDAD1 DEFENDER AGAINST APOPTOTIC DEA... Potri.003G096800 24.73 0.8758 Pt-DAD1.1
AT2G39390 Ribosomal L29 family protein ... Potri.006G214200 28.35 0.8860

Potri.018G052900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.