Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57040 253 / 2e-86 Lactoylglutathione lyase / glyoxalase I family protein (.1) AT1G80160 61 / 1e-11 GLYI7 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT1G15380 61 / 1e-11 GLYI4 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT2G28420 55 / 2e-09 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G129200 [exp] 58 / 1e-10 AT1G80160 225 / 1e-76 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.003G062400 [exp] 56 / 8e-10 AT1G80160 261 / 2e-90 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.001G171600 [exp] 54 / 2e-09 AT1G80160 270 / 6e-94 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.007G015100 [exp] 51 / 5e-08 AT1G15380 167 / 7e-53 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.009G055500 [exp] 49 / 2e-07 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Potri.005G117000 [exp] 49 / 4e-07 AT1G80160 166 / 2e-52 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.003G009000 [exp] 44 / 2e-05 AT1G80160 190 / 8e-62 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017158 [exp] 248 / 2e-84 AT5G57040 254 / 7e-87 Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10021573 [exp] 163 / 3e-51 AT5G57040 163 / 2e-51 Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10021574 [exp] 125 / 7e-38 AT5G57040 132 / 6e-41 Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10030070 [exp] 54 / 5e-09 AT1G80160 247 / 7e-85 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10014480 [exp] 54 / 5e-09 AT1G80160 244 / 1e-83 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10025971 [exp] 49 / 5e-07 AT1G15380 165 / 3e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10039579 [exp] 47 / 2e-06 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10005324 [exp] 46 / 3e-06 AT2G28420 245 / 2e-83 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10014269 [exp] 45 / 6e-06 AT1G15380 166 / 2e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0104 [poplar] [flax] Glyoxalase PF00903 [poplar] [flax] Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence Show only first row Show all	>Potri.018G056200.3 pacid=42801511 polypeptide=Potri.018G056200.3.p locus=Potri.018G056200 ID=Potri.018G056200.3.v4.1 annot-version=v4.1 ATGGCTTCTCTTCCTAGTCCATCAGCCACCGCTGCTCTGCAACACAAGGTGAATTGTGCAACTGCTAAACCTATATCTGTAAACTCACTATGCCATTTTT ATCAAACCAATGTTGGTAGTGGTAGGTCTCCCAGGTTTTGTTTCAAGACAAAAGCTAAGCTTTCTGCTGAAACAAATATAGTTGAGAAAGAATCAACATG TGTCAATGAGAAGATCGATTATGGAGTTGTTAGTGTTCACCATGTTGGAGTGCTGTGTGATAACCTTGAACGGTCTCTTGAATTTTATCAGGGAATCTTA GGGCTTGAAATAAATGAAGAAAGGCCACATGATAAACTTCCCTATAGGGGTGCCTGGTTGTGGGTGGGTTCTGAAATGATCCATTTGATGGAGCTTCCCA ATCCTGACCCCTTAACTGGACGACCTGAACATGGTGGCCGGGATCGACATACTTGCATTGCCATTCAGGATGTGTCCAAGCTAAAAGTGATCCTTGATAA AGCTGGTATTCCATATACACTTAGCCGGTCTGGGAGGCCTGCCATATTTACACGAGATCCAGATACAAATGCTCTAGAATTCAGTCAAGTGGATGGCTGA
AA sequence Show only first row Show all	>Potri.018G056200.3 pacid=42801511 polypeptide=Potri.018G056200.3.p locus=Potri.018G056200 ID=Potri.018G056200.3.v4.1 annot-version=v4.1 MASLPSPSATAALQHKVNCATAKPISVNSLCHFYQTNVGSGRSPRFCFKTKAKLSAETNIVEKESTCVNEKIDYGVVSVHHVGVLCDNLERSLEFYQGIL GLEINEERPHDKLPYRGAWLWVGSEMIHLMELPNPDPLTGRPEHGGRDRHTCIAIQDVSKLKVILDKAGIPYTLSRSGRPAIFTRDPDTNALEFSQVDG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57040			Lactoylglutathione lyase / gly...		Potri.018G056200 [exp]	0	1
AT1G67280			Glyoxalase/Bleomycin resistanc...		Potri.006G160600 [exp]	2.64	0.9783
AT4G10300			RmlC-like cupins superfamily p...		Potri.013G089600 [exp]	3.16	0.9854
AT5G55570			unknown protein		Potri.011G085700 [exp]	4.00	0.9840
AT1G35340			ATP-dependent protease La (LON...		Potri.013G105500 [exp]	5.00	0.9786
AT1G44575		CP22, PSBS, NPQ...	PHOTOSYSTEM II SUBUNIT S, NONP...		Potri.002G083500 [exp]	5.19	0.9804	NPQ4.1
AT4G37930		SHMT1, STM, SHM...	SERINE HYDROXYMETHYLTRANSFERAS...		Potri.010G254700 [exp]	6.92	0.9783	SHMT7,SHM1.3
AT5G23060		CaS	calcium sensing receptor (.1)		Potri.015G052200 [exp]	7.21	0.9792
AT4G21445			unknown protein		Potri.004G033400 [exp]	9.94	0.9754
AT4G01935			unknown protein		Potri.014G117500 [exp]	12.76	0.9382
AT1G11930			Predicted pyridoxal phosphate-...		Potri.004G006600 [exp]	13.22	0.9368

Compare expression of checked genes

Potri.018G056200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.