Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PRO1.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29340 188 / 5e-63 PRF4 profilin 4 (.1) AT2G19770 188 / 1e-62 PRF5 profilin 5 (.1) AT2G19760 187 / 2e-62 PRF1, PFN1 profilin 1 (.1) AT4G29350 182 / 1e-60 PRF2, PFN2, PRO2 profilin 2 (.1) AT5G56600 182 / 3e-60 PRF3, PFN3 profilin 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G235200 [exp] 218 / 7e-75 AT4G29340 216 / 1e-73 profilin 4 (.1) Potri.001G190800 [exp] 215 / 2e-73 AT2G19760 196 / 8e-66 profilin 1 (.1) Potri.003G047700 [exp] 211 / 3e-72 AT4G29340 224 / 5e-77 profilin 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034988 [exp] 209 / 3e-71 AT4G29340 219 / 3e-75 profilin 4 (.1) Lus10012936 [exp] 204 / 3e-69 AT4G29350 223 / 2e-76 profilin 2 (.1) Lus10043040 [exp] 204 / 6e-69 AT5G56600 223 / 1e-76 profilin 3 (.1.2) Lus10011138 [exp] 201 / 4e-68 AT2G19760 225 / 2e-77 profilin 1 (.1) Lus10037591 [exp] 198 / 1e-66 AT2G19770 231 / 6e-80 profilin 5 (.1) Lus10006846 [exp] 196 / 7e-66 AT2G19770 229 / 5e-79 profilin 5 (.1) Lus10011139 [exp] 190 / 2e-63 AT4G29340 238 / 1e-82 profilin 4 (.1) Lus10012935 [exp] 188 / 9e-63 AT4G29340 235 / 2e-81 profilin 4 (.1) Lus10034989 [exp] 187 / 3e-62 AT4G29340 234 / 6e-81 profilin 4 (.1) Lus10043041 [exp] 186 / 6e-62 AT4G29340 239 / 9e-83 profilin 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF00235 [poplar] [flax] Profilin Profilin
Representative CDS sequence Show only first row Show all	>Potri.018G057600.10 pacid=42802078 polypeptide=Potri.018G057600.10.p locus=Potri.018G057600 ID=Potri.018G057600.10.v4.1 annot-version=v4.1 ATGTCGTGGCAGGTGTACGTTGATGACCACTTGATGTGTGACATCGAGGGTAATACCCTCACTTCCGCTGCCATCATCGGCCACGACGGCAGCGTTTGGG CCCTAAGCGCCTCCTTCCCTCAGTTCACCCAAGAAGAAGTGAGCGCGATCATGAAAGATTTTGAGGAACCTGGATCTCTTGCACCAACTGGGTTGTTCCT TGGTGGCACCAAGTACATGGTGATCCAAGGCGAACCTGGAGCTGTTATCCGAGGAAAGAAGGGTTCTGGTGGTGTCACTGTCAAGAAGACCAATCAGGCA CTGATAATTGGCGTGTATGATGAGCCTCTAACTCCCGGTCAATGCAACATGATTGTGGAAAGGCTTGGTGATTATCTAATTGATCAGGGCCTTTAG
AA sequence Show only first row Show all	>Potri.018G057600.10 pacid=42802078 polypeptide=Potri.018G057600.10.p locus=Potri.018G057600 ID=Potri.018G057600.10.v4.1 annot-version=v4.1 MSWQVYVDDHLMCDIEGNTLTSAAIIGHDGSVWALSASFPQFTQEEVSAIMKDFEEPGSLAPTGLFLGGTKYMVIQGEPGAVIRGKKGSGGVTVKKTNQA LIIGVYDEPLTPGQCNMIVERLGDYLIDQGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G29340		PRF4	profilin 4 (.1)		Potri.018G057600 [exp]	0	1	PRO1.3
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.001G236700 [exp]	1.41	0.9090	ADF1,Pt-ADF.5
AT5G20165			unknown protein		Potri.008G176801 [exp]	2.00	0.8898
AT1G80500			SNARE-like superfamily protein...		Potri.001G043400 [exp]	3.46	0.8610
AT4G34490		ATCAP1	cyclase associated protein 1 (...		Potri.009G115500 [exp]	6.48	0.8591	Pt-CAP1.2
AT5G21070			unknown protein		Potri.009G158800 [exp]	8.83	0.8953
AT5G55190		RAN3, ATRAN3	RAN GTPase 3 (.1)		Potri.006G250400 [exp]	8.94	0.8218	Pt-RAN1.1
AT1G51260		LPAT3	lysophosphatidyl acyltransfera...		Potri.001G259200 [exp]	10.39	0.8750
AT3G09735			S1FA-like DNA-binding protein ...		Potri.006G130200 [exp]	11.31	0.8502	S1FA3.1
AT5G56020			Got1/Sft2-like vescicle transp...		Potri.011G164900 [exp]	11.48	0.8618
AT3G53850			Uncharacterised protein family...		Potri.010G198700 [exp]	11.48	0.8413

Compare expression of checked genes

Potri.018G057600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.