Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25890 91 / 5e-24 Oleosin family protein (.1) AT4G25140 74 / 5e-17 OLE1, OLEO1 oleosin 1 (.1) AT5G51210 56 / 8e-11 OLEO3 oleosin3 (.1) AT3G27660 49 / 1e-07 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1) AT5G40420 49 / 1e-07 OLE2, PA23, OLEO2 oleosin 2 (.1) AT3G01570 43 / 1e-05 Oleosin family protein (.1) AT3G18570 40 / 9e-05 Oleosin family protein (.1) AT5G07540 40 / 0.0001 ATGRP16, ATGRP-6, GRP16 glycine-rich protein 16 (.1.2) AT5G07550 39 / 0.0002 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3) AT5G07560 39 / 0.0005 ATGRP20, GRP20 glycine-rich protein 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G234900 [exp] 135 / 8e-42 AT2G25890 113 / 1e-32 Oleosin family protein (.1) Potri.001G080000 [exp] 77 / 1e-18 AT4G25140 108 / 1e-30 oleosin 1 (.1) Potri.003G150600 [exp] 72 / 5e-17 AT4G25140 124 / 3e-37 oleosin 1 (.1) Potri.012G059400 [exp] 47 / 6e-07 AT3G18570 113 / 4e-32 Oleosin family protein (.1) Potri.T125308 [exp] 43 / 1e-05 AT5G40420 108 / 5e-30 oleosin 2 (.1) Potri.015G081901 [exp] 43 / 1e-05 AT5G40420 108 / 5e-30 oleosin 2 (.1) Potri.001G345800 [exp] 42 / 2e-05 AT3G01570 140 / 6e-43 Oleosin family protein (.1) Potri.017G071800 [exp] 40 / 0.0002 AT3G01570 130 / 4e-39 Oleosin family protein (.1) Potri.012G083400 [exp] 38 / 0.0008 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039683 [exp] 76 / 5e-18 AT4G25140 159 / 2e-50 oleosin 1 (.1) Lus10031387 [exp] 74 / 3e-17 AT4G25140 164 / 1e-52 oleosin 1 (.1) Lus10027161 [exp] 73 / 7e-17 AT4G25140 154 / 3e-48 oleosin 1 (.1) Lus10022141 [exp] 74 / 4e-16 AT4G25140 106 / 3e-28 oleosin 1 (.1) Lus10028822 [exp] 67 / 5e-15 AT4G25140 146 / 3e-46 oleosin 1 (.1) Lus10017460 [exp] 67 / 9e-15 AT4G25140 136 / 9e-42 oleosin 1 (.1) Lus10010943 [exp] 70 / 1e-14 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10032461 [exp] 58 / 5e-11 AT3G18570 142 / 1e-43 Oleosin family protein (.1) Lus10042957 [exp] 57 / 9e-11 AT3G18570 139 / 2e-42 Oleosin family protein (.1) Lus10017992 [exp] 53 / 3e-09 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01277 [poplar] [flax] Oleosin Oleosin
Representative CDS sequence Show only first row Show all	>Potri.018G057800.1 pacid=42800736 polypeptide=Potri.018G057800.1.p locus=Potri.018G057800 ID=Potri.018G057800.1.v4.1 annot-version=v4.1 ATGTCGAGGTACGAGCAATCATCAGCACAACCAACTTCACGCAAGGCAGTACTGAAGTTTATGACTGCAGGGACAATAGGTGCAGCACTGTTGGTGTTGT CCGGGTTGACTCTGACCGGAACAGTTATAGCCTTGATCGTGGCTACACCAATTCTGGTGCTGTGTAGTCCGGTTTTGGTCCCAGCAGCCATGGTTGTTTT CTTGGTATCTTCTGGCTTCTTTTTCTCCGGTGGGTGTGGGTTGGCTGCTATAATGGTATTGCTGTGGACATATAATTATGTGACTGGTAAGCATCCACCT GGTGCGGATAGGCTGGATTATGCTACACGGAAGATAGCAGAAAAGGCTAATTCAGTACGTGCAACCAAAGGCTCAAGAAGCTACTCAAACTTCTTAATTG CTTGGGTTAATGGTATAATGTGA
AA sequence Show only first row Show all	>Potri.018G057800.1 pacid=42800736 polypeptide=Potri.018G057800.1.p locus=Potri.018G057800 ID=Potri.018G057800.1.v4.1 annot-version=v4.1 MSRYEQSSAQPTSRKAVLKFMTAGTIGAALLVLSGLTLTGTVIALIVATPILVLCSPVLVPAAMVVFLVSSGFFFSGGCGLAAIMVLLWTYNYVTGKHPP GADRLDYATRKIAEKANSVRATKGSRSYSNFLIAWVNGIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G25890			Oleosin family protein (.1)		Potri.018G057800 [exp]	0	1
AT1G31170		ATSRX	sulfiredoxin (.1.2.3.4)		Potri.015G124601 [exp]	9.16	0.6989
AT1G74500	bHLH	TMO7, PRE3, ATB...	TARGET OF MONOPTEROS 7, activa...		Potri.012G069500 [exp]	10.39	0.6283
AT2G17080			Arabidopsis protein of unknown...		Potri.005G249100 [exp]	18.89	0.6727
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184900 [exp]	19.02	0.6889
					Potri.017G046301 [exp]	26.07	0.6687
AT2G20430		RIC6	ROP-interactive CRIB motif-con...		Potri.002G035500 [exp]	32.43	0.6691
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Potri.004G101950 [exp]	33.94	0.6666
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Potri.008G138600 [exp]	50.95	0.6314
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182800 [exp]	56.37	0.6388
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Potri.004G101900 [exp]	57.96	0.6371

Compare expression of checked genes

Potri.018G057800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.