Potri.018G058200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32915 144 / 6e-45 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037623 127 / 5e-38 AT4G32915 112 / 6e-32 unknown protein
Lus10006882 127 / 5e-38 AT4G32915 111 / 8e-32 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02686 Glu-tRNAGln Glu-tRNAGln amidotransferase C subunit
Representative CDS sequence
>Potri.018G058200.1 pacid=42801664 polypeptide=Potri.018G058200.1.p locus=Potri.018G058200 ID=Potri.018G058200.1.v4.1 annot-version=v4.1
ATGGGAAGCAGAGCTGTTTTGCTACTCAAAGGACCATCACCACCAAAGCATAGCATCCTCTTCCTTCTAAACCACAAAAAAATCAGCCCCGCTCCTTCAA
TACGAAGATTCACAACAAAAGCAACAGCCAATGGGTCCTCTCTTGAACCACCAGATGTCGCTCGCTTGGCTGAAACTGCTAGAATTTCACTAACCCCACA
GCAGGTTGAAGAATTCGGTCCTAAAATCCGACAAGTGATTGATTGGTTTGGACAAATTCAAGCTGTTGACCTTGACAGTGTGGAACCCTCAATCAGAGCA
GACACTGAAGGTGACAACTTGCGTCATGATAATCCTGAAACGTTTGAGAACAGGGAAGCTATCATTGCTGCTGTACCAAACTACGAGGATCCTTACGTCA
AAGTTCCCAAGGTTTTGAACAAGGAGTGA
AA sequence
>Potri.018G058200.1 pacid=42801664 polypeptide=Potri.018G058200.1.p locus=Potri.018G058200 ID=Potri.018G058200.1.v4.1 annot-version=v4.1
MGSRAVLLLKGPSPPKHSILFLLNHKKISPAPSIRRFTTKATANGSSLEPPDVARLAETARISLTPQQVEEFGPKIRQVIDWFGQIQAVDLDSVEPSIRA
DTEGDNLRHDNPETFENREAIIAAVPNYEDPYVKVPKVLNKE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G32915 unknown protein Potri.018G058200 0 1
AT3G44620 protein tyrosine phosphatases;... Potri.004G186400 14.07 0.8738
AT4G38100 unknown protein Potri.005G147801 14.14 0.8721
AT2G39170 unknown protein Potri.010G227400 14.24 0.8309
AT3G57280 Transmembrane proteins 14C (.1... Potri.003G094300 14.42 0.8696
AT5G28750 Bacterial sec-independent tran... Potri.005G053400 15.87 0.8803
AT2G20570 GARP ATGLK1, GLK1, G... ARABIDOPSIS GOLDEN2-LIKE 1, GB... Potri.017G015800 16.24 0.8701
AT2G35830 unknown protein Potri.010G217500 16.82 0.9042
AT2G22860 ATPSK2 phytosulfokine 2 precursor (.1... Potri.014G006900 20.97 0.8579 Pt-PSK3.2
AT4G35000 APX3 ascorbate peroxidase 3 (.1) Potri.009G134100 21.67 0.8967
AT5G42130 AtMfl1 MitoFerrinLike1, Mitochondrial... Potri.005G189600 25.39 0.8946

Potri.018G058200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.