Plant FIBer expression Database

Potri.018G065200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G06520 100 / 1e-28 PSBX photosystem II subunit X (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G144000
[exp]
138 / 2e-43 AT2G06520 97 / 6e-27 photosystem II subunit X (.1)
Potri.006G222300
[exp]
120 / 4e-36 AT2G06520 80 / 2e-20 photosystem II subunit X (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033434
[exp]
102 / 5e-29 AT2G06520 93 / 1e-25 photosystem II subunit X (.1)
Lus10025007
[exp]
45 / 1e-06 AT2G06520 72 / 3e-17 photosystem II subunit X (.1)
Lus10026458
[exp]
42 / 7e-06 AT2G06520 74 / 3e-18 photosystem II subunit X (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Representative CDS sequence
>Potri.018G065200.1 pacid=42801052 polypeptide=Potri.018G065200.1.p locus=Potri.018G065200 ID=Potri.018G065200.1.v4.1 annot-version=v4.1
ATGGCTTCAACTTCAGCTGTTTCAATGGCCATGCCATTAACTCATGCGAGCCGAAAGGCGGCCCCAACCTCCGAGGCTTTCTTCAAGCCACTCCCAGTGA
GGCCATCTAAGGCTATTGCGGCGGCATCAAGATGCAATGGTAGGTTTCAAGTCAAGGCTTCATTGAAGGAGAAGGTAGTCACTGGATTGACAGCAGGTGC
ACTCACGGTTTCCATGGTGATCCCAGAGGTAGCCGAAGCTGCTGGGCCTGGGGTTTCTCCGTCTCTCAATAACTTCTTGCTCAGCATTGTGGCTGGTGGA
GTTGTGCTTGCTGCCATTGCCGGTGCAGTGGTAGGAGTCTCCAATTTCGACCCGGTCAGGCGGAGTTAA
AA sequence
>Potri.018G065200.1 pacid=42801052 polypeptide=Potri.018G065200.1.p locus=Potri.018G065200 ID=Potri.018G065200.1.v4.1 annot-version=v4.1
MASTSAVSMAMPLTHASRKAAPTSEAFFKPLPVRPSKAIAAASRCNGRFQVKASLKEKVVTGLTAGALTVSMVIPEVAEAAGPGVSPSLNNFLLSIVAGG
VVLAAIAGAVVGVSNFDPVRRS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G06520 PSBX photosystem II subunit X (.1) Potri.018G065200
[exp]
0 1
AT2G01710 Chaperone DnaJ-domain superfam... Potri.002G105500
[exp]
9.38 0.6578
AT3G50830 ATCOR413-PM2, C... cold-regulated 413-plasma memb... Potri.004G149100
[exp]
12.08 0.6792
AT5G16790 AtTHO7 Tho complex subunit 7/Mft1p (.... Potri.013G082900
[exp]
16.24 0.6617
AT5G52200 AtI-2 inhibitor-2, phosphoprotein ph... Potri.012G138600
[exp]
18.97 0.6397
Potri.004G236100
[exp]
23.04 0.6512
AT1G75180 Erythronate-4-phosphate dehydr... Potri.002G260900
[exp]
26.64 0.6512
AT5G52990 SNARE-like superfamily protein... Potri.015G012300
[exp]
37.94 0.5527
AT1G73390 Endosomal targeting BRO1-like ... Potri.017G154200
[exp]
38.49 0.6020
AT5G46230 Protein of unknown function, D... Potri.004G064700
[exp]
50.55 0.6116
AT3G26020 Protein phosphatase 2A regulat... Potri.010G054300
[exp]
54.91 0.6055

Potri.018G065200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.