Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47650 140 / 9e-44 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G028500 [exp] 129 / 3e-39 AT3G47650 120 / 4e-36 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Potri.018G016400 [exp] 42 / 3e-05 AT2G24860 165 / 5e-53 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Potri.006G266800 [exp] 41 / 4e-05 AT2G24860 167 / 3e-54 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Potri.019G040400 [exp] 39 / 0.0003 AT5G17840 145 / 4e-45 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Potri.013G066000 [exp] 38 / 0.0006 AT5G17840 145 / 4e-45 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030091 [exp] 152 / 2e-48 AT3G47650 129 / 3e-39 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10005719 [exp] 150 / 4e-48 AT3G47650 130 / 4e-40 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10019417 [exp] 139 / 5e-43 AT3G47650 128 / 2e-38 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10002906 [exp] 118 / 5e-35 AT3G47650 109 / 1e-31 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10043274 [exp] 110 / 9e-32 AT3G47650 107 / 1e-30 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10002020 [exp] 92 / 3e-25 AT3G47650 90 / 7e-25 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10026899 [exp] 44 / 3e-06 AT2G24860 154 / 6e-49 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10001328 [exp] 42 / 4e-05 AT5G17840 143 / 3e-44 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.018G068300.1 pacid=42801446 polypeptide=Potri.018G068300.1.p locus=Potri.018G068300 ID=Potri.018G068300.1.v4.1 annot-version=v4.1 ATGGCAACCGTTGTGAATTCAACACCTCTTTGCCCCTCTGTTTCTCTAAAACGTCCAGCATTCATTGGGAATTCGGTTGCTGGGAAGTTTCTTCGGGCGA AGCCAGTGTTCCATACCTGTAGATTTCCATCCTTGGAGGTCAAGGCTACAGATGGTAGTAACAAAAGCTCCAAAGGCACCAAACCAAAAAGCATAGTCTG TGCTGATTGTGATGGAAATGGTGCAATATCGTGTACTCAATGCAAAGGTTCGGGAGTTAATTCTATGGACCACTTCAATGGACAGTTTAAAGCTGGTGGA TTATGTTGGCTCTGCAGAGGTAAAAGGGAGATTTTGTGTGGAAGTTGTAACGGAGCTGGCTTTCTCGGTGGATTCATGAGCACATTTGATGAATAA
AA sequence Show only first row Show all	>Potri.018G068300.1 pacid=42801446 polypeptide=Potri.018G068300.1.p locus=Potri.018G068300 ID=Potri.018G068300.1.v4.1 annot-version=v4.1 MATVVNSTPLCPSVSLKRPAFIGNSVAGKFLRAKPVFHTCRFPSLEVKATDGSNKSSKGTKPKSIVCADCDGNGAISCTQCKGSGVNSMDHFNGQFKAGG LCWLCRGKREILCGSCNGAGFLGGFMSTFDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Potri.018G068300 [exp]	0	1
AT4G01310			Ribosomal L5P family protein (...		Potri.002G154600 [exp]	2.82	0.9783
AT1G50320		ATHX, ATX	thioredoxin X (.1)		Potri.007G074000 [exp]	3.87	0.9749
AT2G45290			Transketolase (.1)		Potri.002G146300 [exp]	4.24	0.9693
AT2G28190		CZSOD2, CSD2	copper/zinc superoxide dismuta...		Potri.009G163200 [exp]	4.89	0.9777
AT3G14930		HEME1	Uroporphyrinogen decarboxylase...		Potri.001G390800 [exp]	5.47	0.9713
AT1G29070			Ribosomal protein L34 (.1)		Potri.011G064800 [exp]	7.74	0.9723
					Potri.018G012050 [exp]	9.16	0.9703
AT2G42690			alpha/beta-Hydrolases superfam...		Potri.003G101800 [exp]	11.18	0.9607
AT1G50900		LTD, GDC1	LHCP translocation defect, Gra...		Potri.001G420900 [exp]	11.31	0.9657
AT4G15510			Photosystem II reaction center...		Potri.005G010700 [exp]	12.64	0.9684

Compare expression of checked genes

Potri.018G068300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.