Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24450 152 / 3e-48 Heavy metal transport/detoxification superfamily protein (.1) AT2G37390 92 / 3e-23 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT5G02600 91 / 1e-22 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT3G53530 87 / 1e-21 NAKR3 SODIUM POTASSIUM ROOT DEFECTIVE 3, Chloroplast-targeted copper chaperone protein (.1.2) AT2G28660 86 / 3e-21 Chloroplast-targeted copper chaperone protein (.1) AT1G66240 58 / 7e-12 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT5G27690 61 / 1e-11 Heavy metal transport/detoxification superfamily protein (.1) AT3G06130 58 / 1e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G19090 56 / 6e-10 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT3G05220 55 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G234700 [exp] 92 / 2e-23 AT2G37390 114 / 2e-30 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.016G080400 [exp] 89 / 5e-22 AT2G37390 133 / 2e-37 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.006G213900 [exp] 88 / 1e-21 AT2G37390 127 / 2e-35 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.010G236500 [exp] 59 / 2e-12 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.008G023800 [exp] 59 / 3e-12 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3) Potri.010G114300 [exp] 59 / 5e-11 AT1G23000 128 / 2e-33 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G452400 [exp] 55 / 5e-10 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 54 / 7e-10 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.008G202800 [exp] 56 / 8e-10 AT3G06130 150 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017730 [exp] 139 / 3e-43 AT3G24450 134 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1) Lus10024435 [exp] 85 / 3e-20 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10025294 [exp] 82 / 2e-19 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10040870 [exp] 80 / 2e-18 AT2G28660 110 / 2e-28 Chloroplast-targeted copper chaperone protein (.1) Lus10005875 [exp] 79 / 4e-18 AT2G28660 109 / 4e-28 Chloroplast-targeted copper chaperone protein (.1) Lus10028859 [exp] 58 / 4e-11 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3) Lus10043444 [exp] 55 / 2e-10 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3) Lus10032445 [exp] 56 / 9e-10 AT1G23000 129 / 2e-34 Heavy metal transport/detoxification superfamily protein (.1) Lus10031495 [exp] 54 / 4e-09 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) Lus10015174 [exp] 54 / 5e-09 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.018G076400.2 pacid=42801599 polypeptide=Potri.018G076400.2.p locus=Potri.018G076400 ID=Potri.018G076400.2.v4.1 annot-version=v4.1 ATGGGCAAGCTCAGTCTTGGCAAGGTGTTGGACTGCCTTTGTTTTACTACTCCAGGCTCAAGTTGCTCTTGTTTCTGCATCAATTCATTGGATAGTCAAG ACGATGACTTTGAGAAAAAACCGTTGATACCTAGTGACAAGGGCAGGTTGGTGAGGTTGAAAGATGTTGTTGCTGATAACCAAACATTGGCCTTTCAACT GAAGCCCAAGATGGTAGTGCTAAGGGTGTCCATGCACTGCAATGGCTGTGCAAGGAAAGTTAAGAAACATGTTTCAAAGATGGAAGGAGTGAGCTCATAC AAAGTAGACCTGGAAAGCAAGATGGTAGTCGTTATTGGAGACATAATTCCCTTTGAAGTGCTGGAGAGTGTCTCAAGGGTAAAAAATGCTGAGCTCTGGA ATTCTCCATCCTCATGA
AA sequence Show only first row Show all	>Potri.018G076400.2 pacid=42801599 polypeptide=Potri.018G076400.2.p locus=Potri.018G076400 ID=Potri.018G076400.2.v4.1 annot-version=v4.1 MGKLSLGKVLDCLCFTTPGSSCSCFCINSLDSQDDDFEKKPLIPSDKGRLVRLKDVVADNQTLAFQLKPKMVVLRVSMHCNGCARKVKKHVSKMEGVSSY KVDLESKMVVVIGDIIPFEVLESVSRVKNAELWNSPSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G24450			Heavy metal transport/detoxifi...		Potri.018G076400 [exp]	0	1
AT5G14700			NAD(P)-binding Rossmann-fold s...		Potri.017G110500 [exp]	5.91	0.9227
AT4G14550	AUX_IAA	SLR, IAA14	SOLITARY ROOT, indole-3-acetic...		Potri.005G218300 [exp]	6.92	0.9349	Pt-AUX28.2
AT1G49620		ICN6, ICK5, KRP...	KIP-RELATED PROTEIN 7, Cyclin-...		Potri.004G142100 [exp]	10.24	0.9263	Pt-ICK5.2,6
AT5G10610		CYP81K1	"cytochrome P450, family 81, s...		Potri.017G023850 [exp]	11.48	0.9119
AT1G29730			Leucine-rich repeat transmembr...		Potri.011G072991 [exp]	14.79	0.9327
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Potri.013G027000 [exp]	15.68	0.8734	IFS1.31
AT4G14305			Peroxisomal membrane 22 kDa (M...		Potri.010G068900 [exp]	16.85	0.9289
AT1G63245		CLE14	CLAVATA3/ESR-RELATED 14 (.1)		Potri.012G138100 [exp]	17.05	0.8654
AT3G14240			Subtilase family protein (.1)		Potri.018G094400 [exp]	20.78	0.9211
AT3G13310			Chaperone DnaJ-domain superfam...		Potri.007G107600 [exp]	22.44	0.8793

Compare expression of checked genes

Potri.018G076400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.