Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03670 55 / 5e-09 ankyrin repeat family protein (.1) AT4G03500 54 / 1e-08 Ankyrin repeat family protein (.1) AT4G03460 48 / 1e-06 Ankyrin repeat family protein (.1) AT4G03490 47 / 3e-06 Ankyrin repeat family protein (.1.2) AT4G03470 45 / 1e-05 Ankyrin repeat family protein (.1) AT3G01750 44 / 2e-05 Ankyrin repeat family protein (.1) AT2G24600 43 / 5e-05 Ankyrin repeat family protein (.1.2.3.4) AT4G03480 43 / 6e-05 Ankyrin repeat family protein (.1) AT4G03440 42 / 0.0002 Ankyrin repeat family protein (.1) AT3G09550 41 / 0.0003 Ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G077250 [exp] 336 / 9e-114 AT1G03670 165 / 2e-43 ankyrin repeat family protein (.1) Potri.018G078200 [exp] 326 / 1e-109 AT1G03670 157 / 8e-41 ankyrin repeat family protein (.1) Potri.018G077766 [exp] 317 / 5e-106 AT1G03670 152 / 4e-39 ankyrin repeat family protein (.1) Potri.018G077633 [exp] 306 / 5e-102 AT1G03670 159 / 2e-41 ankyrin repeat family protein (.1) Potri.018G078450 [exp] 305 / 1e-101 AT1G03670 154 / 1e-39 ankyrin repeat family protein (.1) Potri.019G101500 [exp] 147 / 2e-41 AT1G03670 212 / 9e-60 ankyrin repeat family protein (.1) Potri.019G101700 [exp] 77 / 2e-16 AT1G03670 182 / 2e-49 ankyrin repeat family protein (.1) Potri.013G133400 [exp] 76 / 2e-16 AT1G03670 184 / 6e-50 ankyrin repeat family protein (.1) Potri.013G134500 [exp] 75 / 6e-16 AT1G03670 167 / 2e-45 ankyrin repeat family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020209 [exp] 55 / 7e-09 AT1G03670 175 / 6e-47 ankyrin repeat family protein (.1) Lus10015224 [exp] 50 / 3e-07 AT1G07710 727 / 0.0 Ankyrin repeat family protein (.1) Lus10005432 [exp] 48 / 2e-06 AT1G07710 720 / 0.0 Ankyrin repeat family protein (.1) Lus10036974 [exp] 42 / 0.0001 AT3G01750 308 / 2e-97 Ankyrin repeat family protein (.1) Lus10022330 [exp] 42 / 0.0001 AT3G01750 633 / 0.0 Ankyrin repeat family protein (.1) Lus10041582 [exp] 40 / 0.0005 AT3G01750 635 / 0.0 Ankyrin repeat family protein (.1) Lus10003986 [exp] 40 / 0.0007 AT3G09550 831 / 0.0 Ankyrin repeat family protein (.1) Lus10015037 [exp] 40 / 0.0007 AT3G09550 849 / 0.0 Ankyrin repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0465 [poplar] [flax] Ank PF12796 [poplar] [flax] Ank_2 Ankyrin repeats (3 copies)
Representative CDS sequence Show only first row Show all	>Potri.018G077500.1 pacid=42801561 polypeptide=Potri.018G077500.1.p locus=Potri.018G077500 ID=Potri.018G077500.1.v4.1 annot-version=v4.1 ATGCCGAGACCAGTACATGATCAGGAGCTTGAACGATGGAAGGCAGTTAAATTCCCAGTTCCGAAGCTTGCAGACTATGGTTTTTCTGAGCCAAATAAAA TACTGCAGAAGGAGTTTTATACCTATGCAAAGGAAGACAACTTCAATGCCTTGTTTGGTCTCTTGTCCGATAAACTGGAACATGTTTCATCAGAGGAAGT GCTCAATGTCATTTTCCAACATGTTGCTGCCTCCGGAAATTCACTGCTTCATGTGGCAGCAAGCCATGGAGGCGAAGGTGTGACACAGCTACTGTGTCAT CACTTCCCCCTCCTAATCACCAGGAAAAATTTCCTGGGTGATAATGCGCTTCATCTGGCTGCCAGGGCTGGACGGTTTGACACAATTCAAAATCTCGTCA AGCATGTGAAAATTCATCATAAAACACTTGAACTTGCTAGCTTGCTGAGGATGAAGAATAATAAAGGAAACACCCCTTTGCATGATCGATGCAGTCATCA AGGGTTGCCAAGAGGTGGCCTGTTTCCTCGTTTATGA
AA sequence Show only first row Show all	>Potri.018G077500.1 pacid=42801561 polypeptide=Potri.018G077500.1.p locus=Potri.018G077500 ID=Potri.018G077500.1.v4.1 annot-version=v4.1 MPRPVHDQELERWKAVKFPVPKLADYGFSEPNKILQKEFYTYAKEDNFNALFGLLSDKLEHVSSEEVLNVIFQHVAASGNSLLHVAASHGGEGVTQLLCH HFPLLITRKNFLGDNALHLAARAGRFDTIQNLVKHVKIHHKTLELASLLRMKNNKGNTPLHDRCSHQGLPRGGLFPRL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G03670			ankyrin repeat family protein ...		Potri.018G077500 [exp]	0	1
AT1G03670			ankyrin repeat family protein ...		Potri.018G078200 [exp]	1.00	0.9300
AT1G07650			Leucine-rich repeat transmembr...		Potri.001G386000 [exp]	2.00	0.9286
AT3G13690			Protein kinase protein with ad...		Potri.006G150100 [exp]	3.46	0.8915
AT5G20670			Protein of unknown function (D...		Potri.012G042000 [exp]	4.24	0.9049
AT5G09220		AAP2	amino acid permease 2 (.1)		Potri.013G103500 [exp]	5.29	0.9119
AT1G32240	GARP	KAN2, KANADI2	KANADI 2, Homeodomain-like sup...		Potri.001G137600 [exp]	5.65	0.9049
AT3G14840			Leucine-rich repeat transmembr...		Potri.001G385500 [exp]	5.74	0.8999
AT3G51430		SSL5, YLS2	YELLOW-LEAF-SPECIFIC GENE 2, S...		Potri.005G099400 [exp]	5.91	0.9067
AT2G20740			Tetraspanin family protein (.1...		Potri.018G038400 [exp]	6.70	0.8883
AT1G03670			ankyrin repeat family protein ...		Potri.018G077250 [exp]	7.07	0.9022

Compare expression of checked genes

Potri.018G077500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.